DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myo31DF and CG31638

DIOPT Version :9

Sequence 1:NP_001188784.1 Gene:Myo31DF / 34445 FlyBaseID:FBgn0086347 Length:1011 Species:Drosophila melanogaster
Sequence 2:NP_723186.2 Gene:CG31638 / 33910 FlyBaseID:FBgn0051638 Length:704 Species:Drosophila melanogaster


Alignment Length:333 Identity:72/333 - (21%)
Similarity:136/333 - (40%) Gaps:62/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 VTDDTLLGAMDKNLSKHPHYTSRQLKPTDKELKHREDFRITHYAGDVIYNINGFIEKNKDTLY-- 523
            :.:..:.|||.|:|::.....:.:.|...::|. ::||. ..|....|..:...:::.:.||.  
  Fly   194 IEEFAMKGAMPKHLTELDEAAAAEEKRLIQQLS-KDDFD-EDYLLQKISMLQLRLDEAQKTLQAE 256

  Fly   524 QDFKRLLHNSKDANLSEMWPEGAQDIKKTTKRPLTAGTLFQRSMADLVVTLLKKEPFYVRCIKPN 588
            :|.|..||.|.:....|:     ||::...:...:|.   |.::.:| :||.::....:|.:  |
  Fly   257 RDEKLELHKSIEKLTLEI-----QDVRGRQEEMRSAK---QEAVREL-LTLQEQHRAEMRIV--N 310

  Fly   589 DLKSSTVFDEERVEHQVRYLGL-LENLRVRRAG-FVHRQRY---------DKFLLRYKMISQYTW 642
            :.....:...|.:|.::..|.. ||:|:...|. :..|:|.         |...||.::      
  Fly   311 NSLQEEIAARENLERRLTELRTELEHLQAENASEWGKRERLESEKLAMERDNKKLRAEL------ 369

  Fly   643 PNFRAGSDR-------DGVRV------LIEEKKFAQDVKYGHTKIFIRSPRTLFALEH--QRNEM 692
            .:::..|||       :.|.:      |.|..|...:||..|.|:......|...|.|  :|.|.
  Fly   370 RDYQERSDRKCRPMQANDVELRALQQELSERNKEISEVKMSHAKLKKLLAETNTELGHAVRRAEQ 434

  Fly   693 IPHIVTLLQKRVRGWIVRRNF----KKMKAAITIVRAYKAYK---------LRSYVQELANRLRK 744
            ....|..|::||..  ::|..    .::.:|:..||..:...         |:..:|.|.||...
  Fly   435 YEAEVKRLRQRVEE--LKRELAGAEDELDSAVNQVRRLQRSNDELVGQTEGLQVQIQHLQNRRAP 497

  Fly   745 AKQMRDYG 752
            :.|:|..|
  Fly   498 SPQLRGMG 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myo31DFNP_001188784.1 MYSc 6..690 CDD:214580 54/256 (21%)
MYSc_Myo1 21..677 CDD:276829 51/241 (21%)
Myosin_TH1 801..983 CDD:283635
CG31638NP_723186.2 DUF4201 284..457 CDD:290581 40/186 (22%)
Ax_dynein_light <300..369 CDD:287215 14/70 (20%)
RILP-like <312..448 CDD:304877 32/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.