DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6144 and ALKBH6

DIOPT Version :9

Sequence 1:NP_001033895.1 Gene:CG6144 / 34443 FlyBaseID:FBgn0032259 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001284630.1 Gene:ALKBH6 / 84964 HGNCID:28243 Length:238 Species:Homo sapiens


Alignment Length:225 Identity:110/225 - (48%)
Similarity:144/225 - (64%) Gaps:9/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FEVRKCPPTVMYIPNFITSEEEQRILSHIERTPKPRWTQLLNRRLVNYGGVPHPNGMIAEEIPEW 70
            |.|.:.||.:.|:|:||:.|||:.:|..:...|||:||||..|:|.|:||:|||.||:.|.:|.|
Human    14 FRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPW 78

  Fly    71 LQTYVDKVNNLGVFESQNANHVLVNEYLPGQGILPHTDGPLFHPIISTISTGAHTVLEFV--KRE 133
            ||.|||||:||.:|....|||||||:||||:||:||.||||::|.:||||.|:||||:|.  :|.
Human    79 LQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRP 143

  Fly   134 DTTTETEAGDQTTREVLFKLLLEPRSLLILKDTLYTDYLHAISETSEDVLCDRIS---NYDLCEN 195
            :....||......|... .|||||||||:|:...||..||.|:....|.| |..|   |...|.:
Human   144 EDDDPTEQPRPPPRPTT-SLLLEPRSLLVLRGPAYTRLLHGIAAARVDAL-DAASSPPNAAACPS 206

  Fly   196 TYKIGDHLVRRSPRISLTIRNVPKTSKMKL 225
            . :.|..|| |..|:|||||.||:..:..|
Human   207 A-RPGACLV-RGTRVSLTIRRVPRVLRAGL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6144NP_001033895.1 2OG-FeII_Oxy 15..215 CDD:304390 101/204 (50%)
ALKBH6NP_001284630.1 2OG-FeII_Oxy 23..224 CDD:419693 101/204 (50%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250 103..105 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..161 4/23 (17%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250 218..224 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159866
Domainoid 1 1.000 129 1.000 Domainoid score I5302
eggNOG 1 0.900 - - E1_KOG3200
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15555
Inparanoid 1 1.050 205 1.000 Inparanoid score I3738
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58390
OrthoDB 1 1.010 - - D1573279at2759
OrthoFinder 1 1.000 - - FOG0005546
OrthoInspector 1 1.000 - - oto91000
orthoMCL 1 0.900 - - OOG6_103545
Panther 1 1.100 - - LDO PTHR46030
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3661
SonicParanoid 1 1.000 - - X4499
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.