DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6144 and AT4G20350

DIOPT Version :9

Sequence 1:NP_001033895.1 Gene:CG6144 / 34443 FlyBaseID:FBgn0032259 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001190780.1 Gene:AT4G20350 / 827783 AraportID:AT4G20350 Length:241 Species:Arabidopsis thaliana


Alignment Length:237 Identity:90/237 - (37%)
Similarity:135/237 - (56%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTVMYIPNFITSEEEQRILSHIERTPKPRWTQLLNRRLVNYGGVPHPNGMIAEEIPEWLQTYVDK 77
            |||.|||.|||.||:.::|:||......:|..|.||||.|:||:.|..|::.:|:|.||.....:
plant    12 PTVFYIPGFITDEEQTQLLNHIYGASGSKWKTLKNRRLQNWGGMVHEKGLVPQELPPWLTKITAE 76

  Fly    78 VN-NLGVFESQNANHVLVNEYLPGQGILPHTDGPLFHPIISTISTGAHTVLEFV----------- 130
            :: :.|:|.|. .||||:|||.|.|||:||.|||.:.|:::.:|.|:..|::|.           
plant    77 IHESSGLFPSA-INHVLINEYHPDQGIMPHQDGPAYFPVVAILSLGSPVVMDFTPHLRLRSGDGY 140

  Fly   131 --KREDTTTETEAGDQTTREVLFKLLLEPRSLLILKDTLYTDYLHAISETSEDVLC-DRISN--- 189
              |.:....|:.|.::.:    |.:||.|:||||.||..|:|:||.||::...  | :::.|   
plant   141 ISKDQSPCAESCAPERDS----FSVLLMPQSLLIFKDDAYSDFLHGISDSPTQ--CYNQVVNEAE 199

  Fly   190 ---YDLCENTYKIGDHLVRR-SPRISLTIRNVPKTSKMKLKF 227
               |...|::.|.||.:..| ..|:|||.|.|||..|...:|
plant   200 ALAYSNEEDSRKDGDKIFHRDQTRVSLTCRLVPKVRKNLFRF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6144NP_001033895.1 2OG-FeII_Oxy 15..215 CDD:304390 82/221 (37%)
AT4G20350NP_001190780.1 2OG-FeII_Oxy 16..141 CDD:304390 50/125 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2309
eggNOG 1 0.900 - - E1_KOG3200
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15555
Inparanoid 1 1.050 153 1.000 Inparanoid score I1695
OMA 1 1.010 - - QHG58390
OrthoDB 1 1.010 - - D1573279at2759
OrthoFinder 1 1.000 - - FOG0005546
OrthoInspector 1 1.000 - - oto3841
orthoMCL 1 0.900 - - OOG6_103545
Panther 1 1.100 - - LDO PTHR46030
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4499
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.