DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6144 and alkbh6

DIOPT Version :9

Sequence 1:NP_001033895.1 Gene:CG6144 / 34443 FlyBaseID:FBgn0032259 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001005390.1 Gene:alkbh6 / 317736 ZFINID:ZDB-GENE-060407-1 Length:234 Species:Danio rerio


Alignment Length:225 Identity:106/225 - (47%)
Similarity:151/225 - (67%) Gaps:4/225 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFTGFEVRKCPPTVMYIPNFITSEEEQRILSHIERTPKPRWTQLLNRRLVNYGGVPHPNGMIAE 65
            :|...:.|::.||||.|||:||:..||:.:|..:.|.|||:||||..|||.|:||:|:|.||:||
Zfish     9 VDLEKYIVKEAPPTVYYIPDFISEAEEEFLLQQVYRAPKPKWTQLSGRRLQNWGGLPNPKGMLAE 73

  Fly    66 EIPEWLQTYVDKVNNLGVFESQNANHVLVNEYLPGQGILPHTDGPLFHPIISTISTGAHTVLEFV 130
            ::|:||..|.:|::.||.|..:.|||||||||.||:||:||.||||:||.::||:.|:||:|:|.
Zfish    74 KLPDWLLEYTEKISALGAFAGKTANHVLVNEYKPGEGIMPHEDGPLYHPTVTTITVGSHTLLDFY 138

  Fly   131 KREDTTTETEAGDQTTREVLFKLLLEPRSLLILKDTLYTDYLHAISETSEDVLCDRISNYDLCEN 195
             |.....|.:|........:..||::.:|||||:|.:|..|||.|....||||.:.:.|  :...
Zfish   139 -RPVCQAEPDAPQTEESRYMLSLLVQRKSLLILQDDMYKCYLHGIRGVCEDVLSEHVVN--ISST 200

  Fly   196 TYKIGDHLVRRSPRISLTIRNVPKTSKMKL 225
            ..::||.| .||.|:|||||:|||..:..|
Zfish   201 GAQVGDTL-PRSTRVSLTIRHVPKIIRANL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6144NP_001033895.1 2OG-FeII_Oxy 15..215 CDD:304390 95/199 (48%)
alkbh6NP_001005390.1 2OG-FeII_Oxy 23..219 CDD:304390 95/199 (48%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250 103..105 1/1 (100%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250 213..219 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596126
Domainoid 1 1.000 154 1.000 Domainoid score I4225
eggNOG 1 0.900 - - E1_KOG3200
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15555
Inparanoid 1 1.050 217 1.000 Inparanoid score I3581
OMA 1 1.010 - - QHG58390
OrthoDB 1 1.010 - - D1573279at2759
OrthoFinder 1 1.000 - - FOG0005546
OrthoInspector 1 1.000 - - oto40067
orthoMCL 1 0.900 - - OOG6_103545
Panther 1 1.100 - - LDO PTHR46030
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3661
SonicParanoid 1 1.000 - - X4499
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.