DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6144 and ofd2

DIOPT Version :9

Sequence 1:NP_001033895.1 Gene:CG6144 / 34443 FlyBaseID:FBgn0032259 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_594941.1 Gene:ofd2 / 2541495 PomBaseID:SPAP8A3.02c Length:225 Species:Schizosaccharomyces pombe


Alignment Length:218 Identity:47/218 - (21%)
Similarity:88/218 - (40%) Gaps:65/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VMYIPNFITSEEEQRILSHIERTPKPRWTQLLNRRLVNYGG-------VPHPNGMIAEEIPEWLQ 72
            :.|.||.:....::.:::::   ||    :||:    .||.       :|.|..:      ..|.
pombe    51 INYYPNCLPESVQRNLINNV---PK----ELLS----IYGSGKQSHLYIPFPAHI------NCLN 98

  Fly    73 TYVDKVNNLGVFESQNANHVLVNEYLPGQGILPHTDGPLFHPIISTISTGAHTVLEFVKREDTTT 137
            .|:.......:::.|:|..:::..|.||.||:||.|..:|...::..|..::|.:.|...|    
pombe    99 DYIPSDFKQRLWKGQDAEAIIMQVYNPGDGIIPHKDLEMFGDGVAIFSFLSNTTMIFTHPE---- 159

  Fly   138 ETEAGDQTTREVLFKLLLEPRSLLILKDTLYTDYLHAISETSEDVLCDRISNYDLCENTYKIGDH 202
                     .::..|:.||..|||::..|...|:.|.|                    .::.||.
pombe   160 ---------LKLKSKIRLEKGSLLLMSGTARYDWFHEI--------------------PFRAGDW 195

  Fly   203 L--------VRRSPRISLTIRNV 217
            :        |.||.|:|:|:|.:
pombe   196 VMNDGEEKWVSRSQRLSVTMRRI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6144NP_001033895.1 2OG-FeII_Oxy 15..215 CDD:304390 46/214 (21%)
ofd2NP_594941.1 AlkB 1..196 CDD:225687 40/194 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2087
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.