DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip75 and emb1427

DIOPT Version :9

Sequence 1:NP_609412.1 Gene:Grip75 / 34441 FlyBaseID:FBgn0026431 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_565235.3 Gene:emb1427 / 844366 AraportID:AT1G80260 Length:995 Species:Arabidopsis thaliana


Alignment Length:395 Identity:78/395 - (19%)
Similarity:162/395 - (41%) Gaps:69/395 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 KTDPLAAKLAELDSDDIYQLWSGRESEFFKMVVDLSNEDTINVFRLEKVIIDIKNYVSARLSEIA 337
            |.:|:..:|..:...:.:.::..|:.::...|:                           ||:: 
plant   612 KAEPMDTRLPVVIMQECFTIYIRRQVDYIGKVI---------------------------LSKL- 648

  Fly   338 VNEVDLERQMGLIKDFFLLGRGEFYLEFCS---QMVGTMETYREERFKNVTRSFELAATVTGITD 399
            :|:..|..::.:::..:|||.|:....|.:   ..:|..|:..::...|:.    |..::....|
plant   649 MNDWKLMHELAVLRAIYLLGSGDLLQHFLTVIFDRLGKGESSNDDFELNII----LQESIRNSAD 709

  Fly   400 DL-----DKFSLICQRSTSEPDDTSD----------------FNFLQGLSLKYEYEWPLNLLFSP 443
            .:     |...:...|...:.||..|                .:.|:.|...|:..|||.|:.:.
plant   710 AMLLSSPDSLVVSISREDRDKDDKGDIIPLSSTRKSRVNSFGIDCLESLKFTYKVPWPLELIANS 774

  Fly   444 TTIERYNNIFRFLLIIRTYQYEIQ--RVWAKQTWRAK-SAKDVPPNNKIITLRNYLMFFLNNMQY 505
            ..|::||.:..|||.::..:|.:.  |.|   .|:.| ||..:..::.:  |...|:.|::....
plant   775 EAIKKYNQVMGFLLKVKRAKYVLDKARRW---MWKGKGSATKIRKHHWL--LEQKLLNFVDAFHQ 834

  Fly   506 YIQVDVLESQFGILMN-VIKSRSDFEVIQRAHTVFLANVLSHCFLLNESETQLNVTGSQNRNPIY 569
            |:...|..:.:..|.. ::|:.|..|||. .|..:|.::...||::.|   :|....:...|.|.
plant   835 YVMDRVYHTAWRELCEAMVKAGSLDEVIY-VHETYLLSIQRQCFVVQE---KLWAIIASRINMIL 895

  Fly   570 GTLLKLFGICEKFAHMTQTKDPSDDLEDEVDQLNESFGVQIASLIQLLVDVKSASCLGPLSQLLL 634
            |..|:.:.|.:..:............|.|:|::.:.|...||.|:::|....:......|:.|:.
plant   896 GLALEFYSIQQTLSSGGAVSAIKARCEMEIDRIEKQFEDCIAFLLRVLSSKLNVGHFPHLADLVT 960

  Fly   635 RLDFN 639
            |:::|
plant   961 RINYN 965

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grip75NP_609412.1 Spc97_Spc98 25..548 CDD:282045 57/302 (19%)
emb1427NP_565235.3 Spc97_Spc98 43..>338 CDD:282045
Spc97_Spc98 <580..877 CDD:282045 57/302 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.