DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip75 and AT3G43610

DIOPT Version :9

Sequence 1:NP_609412.1 Gene:Grip75 / 34441 FlyBaseID:FBgn0026431 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001325537.1 Gene:AT3G43610 / 823458 AraportID:AT3G43610 Length:1208 Species:Arabidopsis thaliana


Alignment Length:475 Identity:91/475 - (19%)
Similarity:170/475 - (35%) Gaps:108/475 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 HNLHQQCEHGDIQLEKAIKI-------IMKPVKNAFF-------------SSLAHWLLFGVIDDV 192
            |::.:.|....:.|.|..|:       .|.|:....|             .||. |..|..:||.
plant   682 HDVLENCLSSKLDLMKDTKVNYPNDVLSMNPLVRCDFLRKHGNTNKRNQGKSLP-WFDFSAVDDP 745

  Fly   193 HSEFFIKFTPTDAVDGSSFSKSATCSLLS-AEKNPEDY-IWQYEVNMSQLPGFFSIVLAEKVLFV 255
            ......:......:|....|.|......| ...|.|.: :...:|:.|||.........||    
plant   746 SKTCITRIPVRVPIDFQKESHSPQTDRKSHRHANQERFDVEDPKVSSSQLSSGIKGCAEEK---- 806

  Fly   256 GQTVLVFKMGR-NVKVKNKTDPLAAKLAELDSDDIYQLWSGRESEFFKMVVDLSNEDTINVFRLE 319
              ....|..|| ...::...:|..:..::...|         .|..|::.:|         |.::
plant   807 --KSNAFGGGRWESMLRRSNNPETSAFSDRRQD---------SSGTFELPLD---------FVID 851

  Fly   320 KVIIDIKNYVSARLSEIAVNEVDLERQMGLIKDFFLLGRGEFYLEFCSQMVGTMETYREERFKN- 383
            |.::...:.....:|::|:..  ||...||.:....|.|..|     .::....:.:....:.: 
plant   852 KCLLQEIHLQYNFVSKLAIKL--LEEGFGLQEHLLALRRYHF-----MELADWADVFVVSLWHHK 909

  Fly   384 --VTRSFELAATVTGITDDLDKFSLICQRSTSEPDDTSDFNFL---QG----------------L 427
              ||.:.:..|.:.|..:.      ..|||:.|.|...|..||   ||                |
plant   910 WLVTEADKRIAEIQGFLES------SIQRSSCERDICKDRIFLYKRQGTMHIPPSTIGVRSFDFL 968

  Fly   428 SLKYEYEWPLNLLFSPTTIERYNNIFRFLLIIRTYQYEIQRVWAKQTWRAKSAKDVPPN------ 486
            .|.|..:||::::.:...:..|.::|.||:.::...|.:..||.       |.|||...      
plant   969 RLGYRVDWPISIILTCDALTAYADVFSFLVQVKLAAYVLTDVWC-------SLKDVRHMMHEKKE 1026

  Fly   487 ----------NKIITLRNYLMFFLNNMQYYIQVDVLESQFGILMNVIKSR-SDFEVIQRAHTVFL 540
                      |.::.||:.:..|:..:|.|:..::....:...::.:|:: .|...::..|..:|
plant  1027 KILKQELRWLNILMKLRHQVNHFVTALQQYVHSELSHVSWSKFLHSLKNKVKDMMDLESVHMAYL 1091

  Fly   541 ANVLS-HCFLLNESETQLNV 559
            :..|. .|||.:|::...|:
plant  1092 SEALRIRCFLSDETQIISNI 1111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grip75NP_609412.1 Spc97_Spc98 25..548 CDD:282045 86/462 (19%)
AT3G43610NP_001325537.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.