DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-2 and rpusd1

DIOPT Version :9

Sequence 1:NP_001188782.2 Gene:RluA-2 / 34440 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001070221.1 Gene:rpusd1 / 767786 ZFINID:ZDB-GENE-060929-444 Length:293 Species:Danio rerio


Alignment Length:292 Identity:72/292 - (24%)
Similarity:112/292 - (38%) Gaps:58/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 PVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAKEHNLKNL---------RTIHR 265
            |.:.:.:.::|...:.:||||...|.:.....|...||...|  :|:...|         |..|:
Zfish     3 PASLENLSVLYQSTNYIVVNKHWDIRIDSKMWYEKQTVQSQL--KHHFPELADPGTYYGFRFCHQ 65

  Fly   266 LDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRFPDGIVECNEKIDVVSYKIG---- 326
            ||..|||.|........|.:.....:.|:|.|.|:..|.|.    :.|.|..:|   :.||    
Zfish    66 LDFSTSGALCVALNKAAAGQAYRCFKDRRVTKAYLALVRGT----VTEENLSLD---FAIGKNTT 123

  Fly   327 ------VCKVSPKG----KDCKT--TFKRIGEVGSDSI--VLCKPLTGRMHQIRVHLQFLGYPIS 377
                  :|....:|    |.|:|  |....|....|.:  ||.:|||||.||:|||...:|:||.
Zfish   124 EGKTHMMCTEGTEGCENPKPCQTEVTVLEYGTYDGDQVTKVLLQPLTGRTHQLRVHCSAIGHPIV 188

  Fly   378 NDPLYN------------HEVFGPLKGRGGDIGGITEEQLISNLISIHNAENWLGLEGDQIVSGE 430
            .|..|:            |..|..:......|.....:..:.:|.:     .|..|....|:...
Zfish   189 GDYTYSLRTDNSPYRMMLHAYFLHIPLHNEPIHVTAPDPFVPSLDA-----KWAPLRCVNILEDL 248

  Fly   431 IKDV-----AASTSVVEAPSVVQAPINSETEK 457
            :|::     ||.....|......:|:.||.::
Zfish   249 LKNILTKLQAAMQEEAEPEPRTSSPVESEEQR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 3/18 (17%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 59/214 (28%)
rpusd1NP_001070221.1 RluA <9..228 CDD:223638 60/227 (26%)
PseudoU_synth_RluCD_like 18..213 CDD:211346 58/203 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D504187at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100211
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.