DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-2 and RPUSD3

DIOPT Version :9

Sequence 1:NP_001188782.2 Gene:RluA-2 / 34440 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_775930.3 Gene:RPUSD3 / 285367 HGNCID:28437 Length:343 Species:Homo sapiens


Alignment Length:216 Identity:55/216 - (25%)
Similarity:95/216 - (43%) Gaps:27/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 LLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAK-EHNL----K 258
            ||...:.|.|: |.:....:|.....:|.:|||..:||  .|:....|:..:|.: ..:|    :
Human    57 LLPKNLSREEL-VDALRAAVVDRKGPLVTLNKPQGLPV--TGKPGELTLFSVLPELSQSLGLREQ 118

  Fly   259 NLRTIHRLDRLTSGLLLFG---RTAEKARELELQIRTRQVQKEYVCRVEGRFP---DGIVECN-- 315
            .|:.:....:.:|||:|..   :||.:.::.....|..|......|.|....|   :|.::..  
Human   119 ELQVVRASGKESSGLVLLSSCPQTASRLQKYFTHARRAQRPTATYCAVTDGIPAASEGKIQAALK 183

  Fly   316 -EKIDVVSYKIGVCKVSPKGKD----CKTTFK--RIGEVGSD-SIVLCKPLTGRMHQIRVHLQFL 372
             |.||.|:..:.|  .:|..||    .|.|..  |:...||. ::|..:|||....|::||:...
Human   184 LEHIDGVNLTVPV--KAPSRKDILEGVKKTLSHFRVVATGSGCALVQLQPLTVFSSQLQVHMVLQ 246

  Fly   373 GYPISNDPLYNHEVFGPLKGR 393
            ..|:..|.:|:..| |.:.|:
Human   247 LCPVLGDHMYSARV-GTVLGQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 7/29 (24%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 50/204 (25%)
RPUSD3NP_775930.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.