DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-2 and ZK287.7

DIOPT Version :10

Sequence 1:NP_609411.1 Gene:RluA-2 / 34440 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_505498.1 Gene:ZK287.7 / 179359 WormBaseID:WBGene00013967 Length:387 Species:Caenorhabditis elegans


Alignment Length:53 Identity:13/53 - (24%)
Similarity:23/53 - (43%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 DVAASTSVVEAPSVVQAPINSETEKPVISKNLEPSNDATAQIATQTCYEEPDR 485
            :.|:|||:..||    ||:|.:.:|.:........|.....::.:.....|.|
 Worm    15 NTASSTSLESAP----APLNPKVQKALTPATFSNPNQLARYLSKKVLAHAPGR 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-2NP_609411.1 PseudoU_synth_ScRIB2 202..386 CDD:211331
ZK287.7NP_505498.1 PseudoU_synth <177..282 CDD:469624
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.