Sequence 1: | NP_001188782.2 | Gene: | RluA-2 / 34440 | FlyBaseID: | FBgn0032256 | Length: | 547 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082285.1 | Gene: | Rpusd1 / 106707 | MGIID: | 1919186 | Length: | 306 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 55/202 - (27%) |
---|---|---|---|
Similarity: | 80/202 - (39%) | Gaps: | 40/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 210 PVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAKEHNLKNL---------RTIHR 265
Fly 266 LDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRFPDGIVECNEKIDVVSYKIGVCKV 330
Fly 331 SPKGK----------DCKTTFKRIGEV--------GSDSI--VLCKPLTGRMHQIRVHLQFLGYP 375
Fly 376 ISNDPLY 382 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RluA-2 | NP_001188782.2 | S4 | 157..229 | CDD:238095 | 6/18 (33%) |
PseudoU_synth_ScRIB2 | 202..386 | CDD:211331 | 55/202 (27%) | ||
Rpusd1 | NP_082285.1 | PseudoU_synth_RluA_like | 18..215 | CDD:211346 | 50/187 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 255..290 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D504187at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100211 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |