DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-1 and PUS5

DIOPT Version :9

Sequence 1:NP_723592.1 Gene:RluA-1 / 34438 FlyBaseID:FBgn0051719 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_013266.1 Gene:PUS5 / 850862 SGDID:S000004155 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:62/230 - (26%)
Similarity:101/230 - (43%) Gaps:63/230 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 IKIVHMDEDIVVVNKPASIPVHP--C---GRYRHN----------TVVFILAKEFNLKNLRTIHR 426
            |.|:..:....:||||..||..|  |   ||...|          ..::...:|..|  .||:||
Yeast     7 IPIIFENTHYFIVNKPPGIPSQPPDCRTWGRTHPNLDPTPLLERFKAIYYSHREVEL--CRTVHR 69

  Fly   427 LDRLTSGLLLFGR----SPKKARQMEQQIRN-RQVEKEYICRVE--GVF--PDGIVECKEPIEVV 482
            ||...:|.:|..:    |.|.:|.:::...| .:::::|:..||  |.|  |:            
Yeast    70 LDHCVTGGMLIAKTKDGSVKFSRFLQKGGNNGYKLQRKYVAIVESSGRFNKPN------------ 122

  Fly   483 SYKIGV-----CKVSAKGKDCTTTFQKLSQNGTTSVVLCKPLTGRMHQIRVHL-QYLGYPILNDP 541
            :|:|..     ..:|..|:: .|.|:::.:|    .::.:.:||:.||||.|: |.|..|||||.
Yeast   123 NYEIKYGPKYNFLISHGGRE-ITKFKEVDEN----CIVLQLVTGKKHQIRNHVSQILNQPILNDK 182

  Fly   542 LYNHEVFGPLKGRSGDIGGKSDEELIRDLINIHNA 576
            .:...|..|              ||..|.|.:|:|
Yeast   183 RHGSTVNFP--------------ELFNDQIALHSA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-1NP_723592.1 Auts2 21..>162 CDD:291981
PseudoU_synth_ScRIB2 363..547 CDD:211331 54/199 (27%)
PUS5NP_013266.1 RluA <4..205 CDD:223638 62/230 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.