DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-1 and rpusd1

DIOPT Version :9

Sequence 1:NP_723592.1 Gene:RluA-1 / 34438 FlyBaseID:FBgn0051719 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001070221.1 Gene:rpusd1 / 767786 ZFINID:ZDB-GENE-060929-444 Length:293 Species:Danio rerio


Alignment Length:337 Identity:77/337 - (22%)
Similarity:122/337 - (36%) Gaps:84/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PVTCQPIKIVHMDEDIVVVNKPASIPVHPCGRYRHNTVVFILAKEF-------NLKNLRTIHRLD 428
            |.:.:.:.:::...:.:||||...|.:.....|...||...|...|       .....|..|:||
Zfish     3 PASLENLSVLYQSTNYIVVNKHWDIRIDSKMWYEKQTVQSQLKHHFPELADPGTYYGFRFCHQLD 67

  Fly   429 RLTSGLLLFGRSPKKARQMEQQIRNRQVEKEYICRVEGVFPDGIVECKEPIEVVSYKIG------ 487
            ..|||.|....:...|.|..:..::|:|.|.|:..|.|...:..:.       :.:.||      
Zfish    68 FSTSGALCVALNKAAAGQAYRCFKDRRVTKAYLALVRGTVTEENLS-------LDFAIGKNTTEG 125

  Fly   488 ----VCKVSAKG----KDCTTTFQKLSQNGT-----TSVVLCKPLTGRMHQIRVHLQYLGYPILN 539
                :|....:|    |.|.|....| :.||     .:.||.:|||||.||:|||...:|:||:.
Zfish   126 KTHMMCTEGTEGCENPKPCQTEVTVL-EYGTYDGDQVTKVLLQPLTGRTHQLRVHCSAIGHPIVG 189

  Fly   540 DPLYNHEVFGPLKGRSGDIGGKSDEELIRDLINIHNAENWLGIDCDSDISMFKSTKDEADRESLS 604
            |..|:.               ::|....|.:::.:    :|.|..                    
Zfish   190 DYTYSL---------------RTDNSPYRMMLHAY----FLHIPL-------------------- 215

  Fly   605 SEHTSVVHHSDDDGCVNSRETTPPCNEPQQPENSVKLLE--TTNAVKEYQVAAQKSSSEICPAPL 667
              |...:|.:..|..|      |..:....|...|.:||  ..|.:.:.| ||.:..:|..|...
Zfish   216 --HNEPIHVTAPDPFV------PSLDAKWAPLRCVNILEDLLKNILTKLQ-AAMQEEAEPEPRTS 271

  Fly   668 DAVESPLNGGGC 679
            ..|||......|
Zfish   272 SPVESEEQRAQC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-1NP_723592.1 Auts2 21..>162 CDD:291981
PseudoU_synth_ScRIB2 363..547 CDD:211331 54/201 (27%)
rpusd1NP_001070221.1 RluA <9..228 CDD:223638 60/267 (22%)
PseudoU_synth_RluCD_like 18..213 CDD:211346 56/221 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D504187at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100211
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.