DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-1 and Rpusd4

DIOPT Version :9

Sequence 1:NP_723592.1 Gene:RluA-1 / 34438 FlyBaseID:FBgn0051719 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_082316.1 Gene:Rpusd4 / 71989 MGIID:1919239 Length:377 Species:Mus musculus


Alignment Length:280 Identity:85/280 - (30%)
Similarity:133/280 - (47%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 FTKGRW------VGEKILDI--FSREFRAHPAEEYERCIQTGTLTVN---FEKVPIDYRLK--HN 358
            ||.|.|      ...:.|:.  .:.:.||...|:..:.::..|..|.   .|.|....:|:  |.
Mouse    24 FTPGSWSFCSSATSSRPLNAQRLAEKLRAQKQEQKAKEVRVPTNPVQRRVQELVRFTQQLQRVHP 88

  Fly   359 DLLANIVHRHEVPVTCQPIKIVHMDEDIVVVNKPASIPVH--PCGRYRHNTVVFILAKEFN---L 418
            ::||..:.|          :|:|.|.|:||:|||..:|||  |..:...:.|:.||||..:   .
Mouse    89 NVLAKELSR----------RILHQDNDLVVINKPYGLPVHGGPGVQLCISDVLPILAKMLHGHKA 143

  Fly   419 KNLRTIHRLDRLTSGLLLFGRSPKKARQMEQQIRNRQVEKEY-ICRVEGVFPD-GIVECKEPI-- 479
            :.|...||||:.|:|:::.......|.|:::..|.|||||:| ...|....|. |:|:.  ||  
Mouse   144 EPLHLCHRLDKETTGVMVLAWEKDMAHQVQELFRTRQVEKKYWAITVRVPLPSAGVVDI--PIKE 206

  Fly   480 -EV------------VSYKIG---VCKVSAKGKD---CTTTFQKLSQNGTTSVVLCKPLTGRMHQ 525
             ||            .||::.   :.||.| .:|   ..|.:|.||...::::|..:|:||..||
Mouse   207 KEVQGPQQHHKMTLSPSYRLDNGKMVKVRA-SRDAHVAVTQYQVLSSASSSALVELQPVTGIKHQ 270

  Fly   526 IRVHLQY-LGYPILNDPLYN 544
            :||||.: |..|||.|..|:
Mouse   271 LRVHLSFGLDCPILGDHKYS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-1NP_723592.1 Auts2 21..>162 CDD:291981
PseudoU_synth_ScRIB2 363..547 CDD:211331 69/211 (33%)
Rpusd4NP_082316.1 rluA_subfam 46..347 CDD:161659 80/258 (31%)
PseudoU_synth_RluCD_like 106..329 CDD:211346 64/188 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.