DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-1 and rpusd4

DIOPT Version :9

Sequence 1:NP_723592.1 Gene:RluA-1 / 34438 FlyBaseID:FBgn0051719 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001003495.1 Gene:rpusd4 / 445101 ZFINID:ZDB-GENE-040801-238 Length:358 Species:Danio rerio


Alignment Length:344 Identity:79/344 - (22%)
Similarity:138/344 - (40%) Gaps:98/344 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 RHEVPVT------------CQPIKIVH--------------MDEDIVVVNKPASIPVHPCGRYRH 405
            ::||||:            .|.::.||              .|::|:.:|||..:|:|.....|:
Zfish    53 KNEVPVSPLQSRVNELKQFSQQLQSVHPSVFAKALYRSSLYEDQNIIAINKPYDVPLHNINGIRN 117

  Fly   406 NTV--VFILAK-EFNLK---NLRTIHRLDRLTSGLLLFGRSPKKARQMEQQIRNRQVEKEYICRV 464
            :..  :.:||| ..|::   .|...|:|::.|:|:|:..::.:.|..::..|::.:||.:|:...
Zfish   118 SIAECLPLLAKITDNMRPGSQLHLCHKLEKETTGVLILAKTEEAAEHVQTLIQSHKVEMKYLAIT 182

  Fly   465 EGV-FP-DGIVECKEPIEVVS-----------------YKI-----GVCKVSA--KGKDCTTTFQ 503
            .|| .| :|:::    |.|:.                 :|:     ||.:|.|  :.....|.:|
Zfish   183 VGVPVPSEGVID----IPVIERAVVGPQPHFKMALSPLFKVNEDGDGVTRVRAHRQAHAAVTRYQ 243

  Fly   504 KLSQNGTTSVVLCKPLTGRMHQIRVHLQY-LGYPILNDPLYNH-EVFGPLKGRSGDIGGKSDEEL 566
            .|......|:|..:||||..:|:|||:.. |..|||.|..|:| ....|         .|..|..
Zfish   244 VLDNTSGCSLVELQPLTGVKNQLRVHMALALTCPILGDHKYSHWSKLAP---------QKLPEGT 299

  Fly   567 IRDLINIHNAENWLGIDCDSDISMFKSTKDEADRESLSSEHTSVVHHSDDDGCVNSRETTPPCNE 631
            :|.|..:.:...:|.:...|...:....|                         ..|:.|..|..
Zfish   300 LRRLGLVQSKTRYLPLHLHSRRIVLPGFK-------------------------GHRDITVSCPL 339

  Fly   632 PQQPENSVKLLETTNAVKE 650
            |:...|::|.||.....||
Zfish   340 PKYFINALKRLEIPLPAKE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-1NP_723592.1 Auts2 21..>162 CDD:291981
PseudoU_synth_ScRIB2 363..547 CDD:211331 61/239 (26%)
rpusd4NP_001003495.1 PseudoU_synth_RluCD_like 98..324 CDD:211346 60/238 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.