DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-1 and Rpusd3

DIOPT Version :9

Sequence 1:NP_723592.1 Gene:RluA-1 / 34438 FlyBaseID:FBgn0051719 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_006237106.1 Gene:Rpusd3 / 362416 RGDID:1307582 Length:346 Species:Rattus norvegicus


Alignment Length:305 Identity:64/305 - (20%)
Similarity:100/305 - (32%) Gaps:95/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 FSREFRAHPAEEYERCIQTGTLTVNFEKVPIDYRLKHNDL----LANIVHRHEVPVTCQPIKIVH 381
            |..|.|..|..:..|..:...|.   |..|....|:..:|    ||.::.          ..:|.
  Rat    29 FGTEARRRPQPQPHRSSKRKDLV---EDQPFPGLLRAENLGLEELAQVLR----------AAVVD 80

  Fly   382 MDEDIVVVNKPASIPVHPCGRYRHNTVVFIL-----AKEFNLKNLRTIHRLDRLTSGLLLFGRSP 441
            ....:|.:|||..:||  .||....|::.:|     |.....:.|:.:....:..|||:|....|
  Rat    81 QKGPLVTLNKPQGLPV--TGRPGELTLLSVLPWLSQALGLEHQELQVVRAPGKEASGLVLLSSCP 143

  Fly   442 KKARQMEQ---QIRNRQVEKEYICRVEGVFPDGIVECKE-------------------PI----- 479
            :....:::   ..|..|......|.:    .||:.|..|                   |:     
  Rat   144 QTTSHLQKFFTHSRRAQRPTATYCAI----TDGVPEPSEGTVHIALRLERMDGIDLAVPVTSPSR 204

  Fly   480 ----EVVSYKIGVCKVSAKGKDCTTTFQKLSQNGTTSVVLCKPLTGRMHQIRVHLQYLGYPILND 540
                |.|...:....|:|.|..|             ::|..:|||....|::||:.....|||.|
  Rat   205 KDIQEGVKRTLSHFHVTATGCGC-------------ALVQLQPLTVFPSQLQVHMALQLCPILGD 256

  Fly   541 PLYNHEVFGPLKGRSGDIGGKS---------------DEELIRDL 570
            ..|        ..|.|.:.|:.               ||.|:|.|
  Rat   257 HTY--------AARVGSVLGQRFLWPAETTKPQRQVLDEALLRYL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-1NP_723592.1 Auts2 21..>162 CDD:291981
PseudoU_synth_ScRIB2 363..547 CDD:211331 44/219 (20%)
Rpusd3XP_006237106.1 PseudoU_synth_RluCD_like 85..270 CDD:211346 46/211 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.