DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-1 and RPUSD3

DIOPT Version :9

Sequence 1:NP_723592.1 Gene:RluA-1 / 34438 FlyBaseID:FBgn0051719 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_775930.3 Gene:RPUSD3 / 285367 HGNCID:28437 Length:343 Species:Homo sapiens


Alignment Length:251 Identity:58/251 - (23%)
Similarity:99/251 - (39%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 LLANIVHRHEVPVTCQPIKIVHMDEDIVVVNKPASIPVHPCGRYRHNTVVFI---LAKEFNLK-- 419
            ||...:.|.|: |......:|.....:|.:|||..:||  .|:....|:..:   |::...|:  
Human    57 LLPKNLSREEL-VDALRAAVVDRKGPLVTLNKPQGLPV--TGKPGELTLFSVLPELSQSLGLREQ 118

  Fly   420 NLRTIHRLDRLTSGLLLFGRSPKKARQMEQ---QIRNRQVEKEYICRVEGVFP------------ 469
            .|:.:....:.:|||:|....|:.|.::::   ..|..|......|.|....|            
Human   119 ELQVVRASGKESSGLVLLSSCPQTASRLQKYFTHARRAQRPTATYCAVTDGIPAASEGKIQAALK 183

  Fly   470 ----DGI---VECKEP-----IEVVSYKIGVCKVSAKGKDCTTTFQKLSQNGTTSVVLCKPLTGR 522
                ||:   |..|.|     :|.|...:...:|.|.|..|             ::|..:|||..
Human   184 LEHIDGVNLTVPVKAPSRKDILEGVKKTLSHFRVVATGSGC-------------ALVQLQPLTVF 235

  Fly   523 MHQIRVHLQYLGYPILNDPLYNHEVFGPLKGRSGDIGGKS--------DEELIRDL 570
            ..|::||:.....|:|.|.:|:..| |.:.|:...:..::        ||.|:|.|
Human   236 SSQLQVHMVLQLCPVLGDHMYSARV-GTVLGQRFLLPAENNKPQRQVLDEALLRRL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-1NP_723592.1 Auts2 21..>162 CDD:291981
PseudoU_synth_ScRIB2 363..547 CDD:211331 48/215 (22%)
RPUSD3NP_775930.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.