DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-1 and RPUSD1

DIOPT Version :9

Sequence 1:NP_723592.1 Gene:RluA-1 / 34438 FlyBaseID:FBgn0051719 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001311015.1 Gene:RPUSD1 / 113000 HGNCID:14173 Length:315 Species:Homo sapiens


Alignment Length:225 Identity:57/225 - (25%)
Similarity:84/225 - (37%) Gaps:55/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PVTCQPIKIVHMDEDIVVVNKPASIPVHPCG-----------RYRHNTVVFILAKEFNLKNLRTI 424
            |.:.:.:.||:...|.:||||...:.:....           |||...    ||........|..
Human     3 PGSVENLSIVYRSRDFLVVNKHWDVRIDSKAWRETLTLQKQLRYRFPE----LADPDTCYGFRFC 63

  Fly   425 HRLDRLTSGLLLFGRSPKKARQMEQQIRNRQVEKEYICRVEGVFPDGIVECKEPIEVVSYKIG-- 487
            |:||..|||.|....:...|....:..:.|:|.|.|:..:.|       ..:|....:|:.||  
Human    64 HQLDFSTSGALCVALNKAAAGSAYRCFKERRVTKAYLALLRG-------HIQESRVTISHAIGRN 121

  Fly   488 --------VCKVSAKG-----------KDCTTTFQKLSQNGTTSVVLCKPLTGRMHQIRVHLQYL 533
                    :|...::|           .|.......|......|.||.||||||.||:|||...|
Human   122 STEGRAHTMCIEGSQGVAGCENPKPSLTDLVVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSAL 186

  Fly   534 GYPILNDPLYNHEVFGPLKGRSGDIGGKSD 563
            |:|::.|..|            |::.|:.|
Human   187 GHPVVGDLTY------------GEVSGRED 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-1NP_723592.1 Auts2 21..>162 CDD:291981
PseudoU_synth_ScRIB2 363..547 CDD:211331 54/207 (26%)
RPUSD1NP_001311015.1 RluA <9..233 CDD:223638 56/219 (26%)
PseudoU_synth_RluCD_like 18..218 CDD:211346 53/210 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D504187at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100211
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.