DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-1 and Rpusd3

DIOPT Version :9

Sequence 1:NP_723592.1 Gene:RluA-1 / 34438 FlyBaseID:FBgn0051719 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001028376.1 Gene:Rpusd3 / 101122 MGIID:2141440 Length:344 Species:Mus musculus


Alignment Length:272 Identity:61/272 - (22%)
Similarity:102/272 - (37%) Gaps:81/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 KHNDL-------------------LANIVHRHEVPVTCQPIKIVHMDEDIVVVNKPASIPVHPCG 401
            ||.||                   ||:::.          ..:|.....:|.:|||..:||  .|
Mouse    44 KHKDLVEDQPFPGLLRTENLGLEELAHVLR----------AAVVDQKGPLVTLNKPQGLPV--TG 96

  Fly   402 RYRHNTVVFIL-----AKEFNLKNLRTIHRLDRLTSGLLLFGRSPKKARQMEQ-QIRNRQVEK-- 458
            |....|::.:|     |.....:.|:.:....:..|||:|....|:.|.:::: .|.:|:.::  
Mouse    97 RPGELTLLSVLPQLSQALGLEHQELQVVRAPGKEASGLVLLSSCPQTASRLQKFFIHSRRAQRPT 161

  Fly   459 EYICRVEGVFPDGIVECKE-----PIEV-----VSYKIGVCKVSAKG-----KDCTTTFQKLSQN 508
            ...|.|    .|||.|..|     |:::     |...:.|...|.|.     |...:.|..::..
Mouse   162 ATYCAV----TDGIPEPSEGTVCMPLKMEQMNDVDLAVPVMSPSRKDIQEGVKRTLSRFHVMATG 222

  Fly   509 GTTSVVLCKPLTGRMHQIRVHLQYLGYPILNDPLYNHEVFGPLKGRSGDIGGKS----------- 562
            ...::|..:|||...:|::||:.....|||.|..|        ..|.|.:.|:.           
Mouse   223 RGCALVQLQPLTVFPNQLQVHMALQLCPILGDHTY--------AARVGTVLGQRFLWPAETTKPQ 279

  Fly   563 ----DEELIRDL 570
                ||.|:|.|
Mouse   280 RQVLDEALLRHL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RluA-1NP_723592.1 Auts2 21..>162 CDD:291981
PseudoU_synth_ScRIB2 363..547 CDD:211331 47/206 (23%)
Rpusd3NP_001028376.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..53 4/8 (50%)
PseudoU_synth_RluCD_like 83..268 CDD:211346 49/198 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.