DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loh and ADAMTS4

DIOPT Version :9

Sequence 1:NP_609406.2 Gene:loh / 34435 FlyBaseID:FBgn0032252 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_001307265.1 Gene:ADAMTS4 / 9507 HGNCID:220 Length:846 Species:Homo sapiens


Alignment Length:193 Identity:58/193 - (30%)
Similarity:74/193 - (38%) Gaps:48/193 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 WDKWSDWSSCSRSCGGGVKYQVRKC---INRNLLTNNQLTSNACVGYFKRYQLCNDVPCDEQSP- 242
            |..|..|..|||:|||||::..|.|   :.||       ....|.|...|::.||...|...|. 
Human   523 WGPWGPWGDCSRTCGGGVQFSSRDCTRPVPRN-------GGKYCEGRRTRFRSCNTEDCPTGSAL 580

  Fly   243 DFRASQCSAYND-----KEFHGHRYRWEPY---VKDDAECELNCMPFGMKSFATLNESVIDGTPC 299
            .||..||:|||.     |.|.| ...|.|.   |....:|:|.|....:..:..|...|:|||||
Human   581 TFREEQCAAYNHRTDLFKSFPG-PMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPC 644

  Fly   300 GHPAEYFRSQFWERAVCVDGAC----------------KAVQASGEIDGLYAHSGS---VSCG 343
            ...:.         :|||.|.|                |.:...|:..|....|||   ..||
Human   645 SPDSS---------SVCVQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRCG 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lohNP_609406.2 TSP1 182..238 CDD:214559 20/58 (34%)
ADAM_spacer1 348..468 CDD:283607
TSP1 667..716 CDD:214559
TSP1 779..835 CDD:214559
PLAC 847..877 CDD:285849
ADAMTS4NP_001307265.1 Pep_M12B_propep 70..181 CDD:279848
Cysteine switch. /evidence=ECO:0000250 192..199
Reprolysin 218..428 CDD:279729
ZnMc_ADAMTS_like 218..425 CDD:239801
ADAM_CR 438..509 CDD:301627
ADAM_CR 490..659 CDD:301627 50/152 (33%)
TSP1 531..575 CDD:214559 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.