DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment loh and ADAMTSL5

DIOPT Version :9

Sequence 1:NP_609406.2 Gene:loh / 34435 FlyBaseID:FBgn0032252 Length:880 Species:Drosophila melanogaster
Sequence 2:XP_011526263.1 Gene:ADAMTSL5 / 339366 HGNCID:27912 Length:485 Species:Homo sapiens


Alignment Length:298 Identity:91/298 - (30%)
Similarity:131/298 - (43%) Gaps:41/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 WDKWSDWSSCSRSCGGGVKYQVRKCINRNLLTNNQLTSNACVGYFKRYQLCNDVPCDEQSPDFRA 246
            |..|..|:.||.|||.||..:.|:|:.   |...:    .|.|....|:||....|...:..||.
Human    48 WTPWVSWTRCSSSCGRGVSVRSRRCLR---LPGEE----PCWGDSHEYRLCQLPDCPPGAVPFRD 105

  Fly   247 SQCSAYNDKEFHGHR--YRWEPYVKDDAECELNCMPFGMKSFATLNESVIDGTPCGHPAEYFRSQ 309
            .||:.||.:...|.:  |:|.|:.....:|:|||:..|...:.:... |:|||.|...|:     
Human   106 LQCALYNGRPVLGTQKTYQWVPFHGAPNQCDLNCLAEGHAFYHSFGR-VLDGTACSPGAQ----- 164

  Fly   310 FWERAVCVDGACKAVQASGEIDGLYAHSGSVS-----CGGL--LCRPVTGIFTRNPLPEHAYIHV 367
                .|||.|.|    .|...|||.. ||::.     |||.  .|..|..:| |:......|.:|
Human   165 ----GVCVAGRC----LSAGCDGLLG-SGALEDRCGRCGGANDSCLFVQRVF-RDAGAFAGYWNV 219

  Fly   368 TTLPVGASNISIT-ELKNSINLL-VLRTSNELAIFNGENTVSESGSYEAVGAVFDYHRIDGAEDS 430
            |.:|.||.:|.:. ..:|.:.:| .|...:...:.||...||..|:|||.|....|.|      .
Human   220 TLIPEGARHIRVEHRSRNHLGILGSLMGGDGRYVLNGHWVVSPPGTYEAAGTHVVYTR------D 278

  Fly   431 NGVTEWITSIGPIRDSLQLMVFTKSANNTGVKYEYMLP 468
            .|..|.:.:.||....|.|.|..:.. |.|:::|:.||
Human   279 TGPQETLQAAGPTSHDLLLQVLLQEP-NPGIEFEFWLP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lohNP_609406.2 TSP1 182..238 CDD:214559 18/55 (33%)
ADAM_spacer1 348..468 CDD:283607 34/121 (28%)
TSP1 667..716 CDD:214559
TSP1 779..835 CDD:214559
PLAC 847..877 CDD:285849
ADAMTSL5XP_011526263.1 TSP1 48..97 CDD:214559 18/55 (33%)
ADAM_CR <106..174 CDD:301627 24/81 (30%)
ADAM_spacer1 206..315 CDD:283607 33/116 (28%)
NTR_like 379..480 CDD:239600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.