DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nse4 and AT3G20760

DIOPT Version :9

Sequence 1:NP_001162938.1 Gene:Nse4 / 34434 FlyBaseID:FBgn0032251 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_188712.4 Gene:AT3G20760 / 821624 AraportID:AT3G20760 Length:383 Species:Arabidopsis thaliana


Alignment Length:311 Identity:65/311 - (20%)
Similarity:116/311 - (37%) Gaps:75/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSSESQSQMDDQDARILRLQNLIEKNIEIEQQIENNTIGESITAIEEIIQTANDISKGHEDRRTN 66
            |:.:..:::|..     :..::|.:...:.|::....  |.|...|.::...|.:....:.:..:
plant    78 DAKDDLTKIDSN-----KFNSIINEVENLHQKVRKPR--EQIADAEALLDLTNSVVSSVKSQSAH 135

  Fly    67 STELVLDTELLRRNFEVVGKA-----IQHNTNVTDRMVATAINDLVFKESEEDWDALCSLAI--- 123
            ..  |...|.:.......||.     ...||.|:.:.     .||.|        .:||..:   
plant   136 GG--VSPAEFVNALINGFGKTSLRIDADENTQVSMKW-----KDLGF--------TVCSTVLVSC 185

  Fly   124 ----QFGRPLFTNDSMLPFIDVTPKVVVQKQRAPR-----KTKSQVDEKRPEKSD--QLERKDEG 177
                ..| |:::.               .|||..|     :||.....| ||:.|  :.|:|.:.
plant   186 GCTTMMG-PMYSE---------------MKQRKSRVGNRKRTKPGAGVK-PEEVDDTEAEKKSDT 233

  Fly   178 AASVTHMLKQIRQIYRDGNQEPIPYFKLICNPNNFMDTVQNALQLSFLVKENYISIENGEDGLPL 242
            ..::..|...:|:..|      :....|:.|..:|..|.:|...||||||:..:.|....:|   
plant   234 DNNMAVMFNILRKNKR------VKIENLVLNRKSFAQTAENMFALSFLVKDGRVEITVDNNG--- 289

  Fly   243 VRVVNSKSVE-GNAP-SQAICSIDVTFCEKMVK-HYNLHEPMLKRLPVSEK 290
                 |..|| .||| :..:.|.:|.:...::: .|...|||.|.:.|.|:
plant   290 -----SHFVEPRNAPAANLVLSGEVAYNHFVLRFDYKDWEPMSKMVAVGEE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nse4NP_001162938.1 Nse4_C 200..282 CDD:285900 24/84 (29%)
AT3G20760NP_188712.4 Nse4_C 250..338 CDD:285900 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5125
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D935469at2759
OrthoFinder 1 1.000 - - FOG0002403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102377
Panther 1 1.100 - - O PTHR16140
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.