DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nse4 and Eid3

DIOPT Version :9

Sequence 1:NP_001162938.1 Gene:Nse4 / 34434 FlyBaseID:FBgn0032251 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001037769.2 Gene:Eid3 / 691688 RGDID:1597206 Length:387 Species:Rattus norvegicus


Alignment Length:324 Identity:79/324 - (24%)
Similarity:139/324 - (42%) Gaps:76/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MDDQDARILRLQ--NLIEKNIEIEQQIEN--NTIGESITAIEEIIQTANDISKGHEDRRTNSTE- 69
            :|.:..|.:|.|  .||   ..::|..|:  ||..:|:|   |.::.||.:..|....|..:.: 
  Rat    87 VDREKCRSIRRQYRQLI---YTVQQNREDIVNTASDSLT---EALEEANVLFDGVSRTREAALDA 145

  Fly    70 --LVLDTELLRRNFEVVGKAIQHNTNVTDRMVATAINDLVFKE----------SEEDWDAL--C- 119
              |||.::|.:.      ||.|.|:::      :..|.:.|.|          .||:.:.|  | 
  Rat   146 QFLVLASDLGKE------KAKQLNSDM------SFFNHVAFCELLLVFVGLNWMEEECEELSECD 198

  Fly   120 -SLAIQFGRPLFTNDS--MLP-----FIDVTPKVVVQKQRAPRKTKSQVDEKR----------PE 166
             |:|:.|...|....:  ||.     ||..:.|.    :|:.||.: |...||          |.
  Rat   199 ESIALSFWNMLHKEATAWMLQAETFHFIFGSFKA----ERSARKPR-QEHHKRACKMEGNGDMPT 258

  Fly   167 KSDQL------ERKDEGAASVTHMLKQIRQIYRDGNQEPIPYFKLICNPNNFMDTVQNALQLSFL 225
            |..:|      |..::....:..:|:...|.|.|   .|:.||:.:.:||:|..||:|...:||:
  Rat   259 KLRKLDVHANQETTEKEVERILGLLQTYFQKYPD---TPVSYFEFVIDPNSFSRTVENIFYVSFI 320

  Fly   226 VKENYISIENGEDGLPLVRVVNSKSVEGNAPS------QAICSIDVTFCEKMVKHYNLHEPMLK 283
            :::.:..|...:|.||::...|...|:....|      |.:.|:.:...:.:|..:.:.|.|:|
  Rat   321 IRDGFARIRLDQDRLPILEPTNVNQVDEENDSCSYCRKQGVISLSLQDWKNIVSTFEISEAMIK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nse4NP_001162938.1 Nse4_C 200..282 CDD:285900 21/87 (24%)
Eid3NP_001037769.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Nse4-Nse3_bdg 144..187 CDD:292054 11/54 (20%)
PI-PLCc_GDPD_SF <253..>296 CDD:301322 9/45 (20%)
Nse4_C 295..383 CDD:285900 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11287
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D465236at33208
OrthoFinder 1 1.000 - - FOG0002403
OrthoInspector 1 1.000 - - otm45507
orthoMCL 1 0.900 - - OOG6_102377
Panther 1 1.100 - - O PTHR16140
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.