| Sequence 1: | NP_477441.1 | Gene: | STUB1 / 34433 | FlyBaseID: | FBgn0027052 | Length: | 289 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_011985.1 | Gene: | TOM71 / 856517 | SGDID: | S000001159 | Length: | 639 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 202 | Identity: | 45/202 - (22%) |
|---|---|---|---|
| Similarity: | 81/202 - (40%) | Gaps: | 20/202 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 15 LQLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDG 79
Fly 80 NLLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQKQNFGDDITLQLRLAR---KKRWNVMEEK 141
Fly 142 RIQQE----------IELQSYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQEIEQECDDHIKE 196
Fly 197 LNNIFSK 203 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| STUB1 | NP_477441.1 | TPR_11 | 17..78 | CDD:290150 | 17/60 (28%) |
| TPR | 17..47 | CDD:197478 | 12/29 (41%) | ||
| TPR repeat | 17..42 | CDD:276809 | 10/24 (42%) | ||
| TPR repeat | 47..77 | CDD:276809 | 5/29 (17%) | ||
| TPR repeat | 82..110 | CDD:276809 | 4/27 (15%) | ||
| U-box | 213..285 | CDD:252675 | |||
| TOM71 | NP_011985.1 | 3a0801s09 | 9..636 | CDD:273380 | 45/202 (22%) |
| TPR repeat | 127..155 | CDD:276809 | 11/26 (42%) | ||
| TPR repeat | 160..190 | CDD:276809 | 5/29 (17%) | ||
| TPR repeat | 195..218 | CDD:276809 | 4/28 (14%) | ||
| TPR repeat | 345..373 | CDD:276809 | |||
| TPR repeat | 378..406 | CDD:276809 | |||
| TPR repeat | 411..441 | CDD:276809 | |||
| TPR repeat | 446..471 | CDD:276809 | |||
| TPR repeat | 480..508 | CDD:276809 | |||
| TPR repeat | 513..559 | CDD:276809 | |||
| TPR repeat | 564..588 | CDD:276809 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C157345408 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||