DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and TOM70

DIOPT Version :9

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_014278.3 Gene:TOM70 / 855602 SGDID:S000005065 Length:617 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:53/231 - (22%)
Similarity:97/231 - (41%) Gaps:65/231 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LQLKEQGNCLFAARKYDDAINCYSKAI-IKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDID 78
            |.||::||..|..:||||||..|:.|: :|.  :..:::|.:.|.:.:...:...:.|.:||::.
Yeast   100 LALKDKGNQFFRNKKYDDAIKYYNWALELKE--DPVFYSNLSACYVSVGDLKKVVEMSTKALELK 162

  Fly    79 ---GNLLKGHFFLGQGLMEIDN--FDEAIKHLQRAY-----------DLSKEQ----KQNFGD-- 121
               ..:|.......:||.:..:  ||.::..|...:           :|:|:.    |:.|||  
Yeast   163 PDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDID 227

  Fly   122 -------DITLQLRLARK-KRWNVME--------------------EKRIQQEIELQSYLNGLIK 158
                   :::.|....|| |:.|:..                    ::..:.:.||.:.|:.|.|
Yeast   228 TATATPTELSTQPAKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYK 292

  Fly   159 GDMES------------RLANLKLNGNVHDEQLKDK 182
            ...||            ||...:|:.|..||:||:|
Yeast   293 RSPESYDKADESFTKAARLFEEQLDKNNEDEKLKEK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 19/61 (31%)
TPR 17..47 CDD:197478 14/30 (47%)
TPR repeat 17..42 CDD:276809 13/25 (52%)
TPR repeat 47..77 CDD:276809 5/29 (17%)
TPR repeat 82..110 CDD:276809 6/40 (15%)
U-box 213..285 CDD:252675
TOM70NP_014278.3 3a0801s09 1..614 CDD:273380 53/231 (23%)
TPR repeat 99..127 CDD:276809 14/26 (54%)
TPR repeat 131..161 CDD:276809 5/29 (17%)
TPR repeat 166..189 CDD:276809 4/22 (18%)
TPR repeat 330..358 CDD:276809
TPR repeat 363..391 CDD:276809
TPR repeat 396..426 CDD:276809
TPR repeat 431..459 CDD:276809
TPR repeat 465..493 CDD:276809
TPR repeat 498..537 CDD:276809
TPR repeat 542..567 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.