Sequence 1: | NP_477441.1 | Gene: | STUB1 / 34433 | FlyBaseID: | FBgn0027052 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014278.3 | Gene: | TOM70 / 855602 | SGDID: | S000005065 | Length: | 617 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 231 | Identity: | 53/231 - (22%) |
---|---|---|---|
Similarity: | 97/231 - (41%) | Gaps: | 65/231 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 LQLKEQGNCLFAARKYDDAINCYSKAI-IKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDID 78
Fly 79 ---GNLLKGHFFLGQGLMEIDN--FDEAIKHLQRAY-----------DLSKEQ----KQNFGD-- 121
Fly 122 -------DITLQLRLARK-KRWNVME--------------------EKRIQQEIELQSYLNGLIK 158
Fly 159 GDMES------------RLANLKLNGNVHDEQLKDK 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
STUB1 | NP_477441.1 | TPR_11 | 17..78 | CDD:290150 | 19/61 (31%) |
TPR | 17..47 | CDD:197478 | 14/30 (47%) | ||
TPR repeat | 17..42 | CDD:276809 | 13/25 (52%) | ||
TPR repeat | 47..77 | CDD:276809 | 5/29 (17%) | ||
TPR repeat | 82..110 | CDD:276809 | 6/40 (15%) | ||
U-box | 213..285 | CDD:252675 | |||
TOM70 | NP_014278.3 | 3a0801s09 | 1..614 | CDD:273380 | 53/231 (23%) |
TPR repeat | 99..127 | CDD:276809 | 14/26 (54%) | ||
TPR repeat | 131..161 | CDD:276809 | 5/29 (17%) | ||
TPR repeat | 166..189 | CDD:276809 | 4/22 (18%) | ||
TPR repeat | 330..358 | CDD:276809 | |||
TPR repeat | 363..391 | CDD:276809 | |||
TPR repeat | 396..426 | CDD:276809 | |||
TPR repeat | 431..459 | CDD:276809 | |||
TPR repeat | 465..493 | CDD:276809 | |||
TPR repeat | 498..537 | CDD:276809 | |||
TPR repeat | 542..567 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C157345409 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |