DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and TAH1

DIOPT Version :9

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_009986.1 Gene:TAH1 / 850424 SGDID:S000000656 Length:111 Species:Saccharomyces cerevisiae


Alignment Length:111 Identity:31/111 - (27%)
Similarity:49/111 - (44%) Gaps:23/111 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRW----ELCCQDSRRALDID 78
            |||||.||....|.:|::||.:.|...|.|...::|:|:..:||..:    ::|.|..|.....:
Yeast     8 KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAE 72

  Fly    79 ----GNLLKGHFFLGQG--------LMEIDNFDEAIKHLQRAYDLS 112
                .:.|:....|.||        ::|:|...|       .||.|
Yeast    73 HVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPE-------GYDRS 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 21/63 (33%)
TPR 17..47 CDD:197478 13/28 (46%)
TPR repeat 17..42 CDD:276809 11/23 (48%)
TPR repeat 47..77 CDD:276809 8/33 (24%)
TPR repeat 82..110 CDD:276809 7/35 (20%)
U-box 213..285 CDD:252675
TAH1NP_009986.1 TPR repeat 8..32 CDD:276809 11/23 (48%)
C39_PA2778_fam <11..68 CDD:411481 18/56 (32%)
TPR repeat 37..67 CDD:276809 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1797
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3168
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.