DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and TPR5

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_176039.2 Gene:TPR5 / 842097 AraportID:AT1G56440 Length:476 Species:Arabidopsis thaliana


Alignment Length:232 Identity:63/232 - (27%)
Similarity:106/232 - (45%) Gaps:24/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDGNLL 82
            |||||..|..:|:::||:|||::|..:| ||..:.|||:..||:||:.....|...||::|...:
plant    88 KEQGNEFFKQKKFNEAIDCYSRSIALSP-NAVTYANRAMAYLKIKRYREAEVDCTEALNLDDRYI 151

  Fly    83 KGHFFLGQGLMEIDNFDEAIKHLQRAYDL---SKEQKQNFGDDITLQLRLARKKRWNVMEEKRIQ 144
            |.:........|:....||.:..:.|..|   |:|.|:.:.|..:|..:...:|....|:.  ..
plant   152 KAYSRRATARKELGMIKEAKEDAEFALRLEPESQELKKQYADIKSLLEKEIIEKATGAMQS--TA 214

  Fly   145 QEIELQSYLNGLI---KGDMESRLANL--KLNGNVHDEQLKDKQQEIEQECDDHIKELNNIFSKV 204
            ||:...|.|:..|   |.:|.|:...|  |.|.::....|...:...:       |.:.||..:.
plant   215 QELLKTSGLDKKIQKPKTEMTSKPVTLVAKTNRDIVQPVLGSNESSGK-------KLIENIQPEE 272

  Fly   205 DERRKKREVPDFLCGKISFEILTDPVITPSGITYERK 241
            ..:....::|...      |||....:||...:||::
plant   273 KSKEGSMKIPAIT------EILDSKKVTPGSQSYEKE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 12/23 (52%)
TPR 21..>111 CDD:440225 29/89 (33%)
TPR repeat 47..77 CDD:276809 12/29 (41%)
TPR repeat 82..110 CDD:276809 5/27 (19%)
CHIP_TPR_N 130..211 CDD:436460 17/85 (20%)
RING-Ubox_CHIP 213..283 CDD:438316 8/29 (28%)
TPR5NP_176039.2 TPR repeat 88..112 CDD:276809 12/23 (52%)
TPR 91..>218 CDD:440225 39/129 (30%)
TPR repeat 116..146 CDD:276809 12/29 (41%)
TPR repeat 151..179 CDD:276809 5/27 (19%)
RPAP3_C 353..441 CDD:464012
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.