DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and CHIP

DIOPT Version :9

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_566305.1 Gene:CHIP / 819925 AraportID:AT3G07370 Length:278 Species:Arabidopsis thaliana


Alignment Length:273 Identity:98/273 - (35%)
Similarity:148/273 - (54%) Gaps:13/273 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDGN 80
            :|||.||..|...::..||:.|::||..:|....|:||||||::|.|.|....:|.|:|:.:..|
plant    12 RLKEDGNNCFKKERFGAAIDAYTEAIALSPNVPAYWTNRALCHMKRKDWTKVEEDCRKAIQLVHN 76

  Fly    81 LLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQKQN--FGDDITLQLRLARKKRWNVMEEKRI 143
            .:|.|:.||..|::...|...:|.||||.||.:.....  ..::|..:|..|:...|.::...| 
plant    77 SVKAHYMLGLALLQKKEFTNGVKELQRALDLGRCSNPTGYMVEEIWEELSKAKYMEWELVSAMR- 140

  Fly   144 QQEIELQSYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQEIEQECDDHIKELNNIFSKVDERR 208
              ..||.|     :|...|:.|...:.......|:..|:......|   .:|.|..:|.|..|..
plant   141 --SWELNS-----LKETCEAALNQQRALDMSRTEESSDEAYTAHTE---RLKALERVFKKAAEED 195

  Fly   209 KKREVPDFLCGKISFEILTDPVITPSGITYERKDIEEHLQRVGHFDPVTRVKLTQDQLIPNFSMK 273
            |..||||:||..|:.||..||||:|||:||||..|.|||::||.|||:||.|:....|:||.::|
plant   196 KPTEVPDYLCCNITLEIFRDPVISPSGVTYERAAILEHLKKVGKFDPITREKIDPANLVPNLAIK 260

  Fly   274 EVVDSFIAENEWS 286
            |.|.:::.::.|:
plant   261 EAVAAYLEKHVWA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 25/60 (42%)
TPR 17..47 CDD:197478 12/29 (41%)
TPR repeat 17..42 CDD:276809 10/24 (42%)
TPR repeat 47..77 CDD:276809 13/29 (45%)
TPR repeat 82..110 CDD:276809 11/27 (41%)
U-box 213..285 CDD:252675 37/71 (52%)
CHIPNP_566305.1 3a0801s09 <8..>80 CDD:273380 26/67 (39%)
TPR repeat 10..38 CDD:276809 10/25 (40%)
TPR repeat 43..73 CDD:276809 13/29 (45%)
TPR repeat 78..106 CDD:276809 11/27 (41%)
TPR repeat 119..143 CDD:276809 5/26 (19%)
RING-Ubox_CHIP 200..266 CDD:319568 37/65 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2731
eggNOG 1 0.900 - - E1_KOG4642
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4281
Inparanoid 1 1.050 172 1.000 Inparanoid score I1528
OMA 1 1.010 - - QHG57751
OrthoDB 1 1.010 - - D1422450at2759
OrthoFinder 1 1.000 - - FOG0005678
OrthoInspector 1 1.000 - - oto3856
orthoMCL 1 0.900 - - OOG6_103776
Panther 1 1.100 - - LDO PTHR46803
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.