DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and TTL3

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_565976.1 Gene:TTL3 / 818858 AraportID:AT2G42580 Length:691 Species:Arabidopsis thaliana


Alignment Length:123 Identity:31/123 - (25%)
Similarity:54/123 - (43%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDGN 80
            :||..||.::....:.:|::.|.:||:.:|.||.|.:|||.....|:|.....::...|:.||.:
plant   222 ELKRMGNDMYRRGSFSEALSLYDRAILISPGNAAYRSNRAAALTALRRLGEAVKECLEAVRIDPS 286

  Fly    81 LLKGHFFLGQGLMEIDNFDEAIKH------------LQRAYDLSKE-----QKQNFGD 121
            ..:.|..|....:.:...:.|.:|            |||...|.|.     :.:..||
plant   287 YSRAHQRLASLYLRLGEAENARRHICFSGQCPDQADLQRLQTLEKHLRRCWEARKIGD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 7/24 (29%)
TPR 21..>111 CDD:440225 25/101 (25%)
TPR repeat 47..77 CDD:276809 9/29 (31%)
TPR repeat 82..110 CDD:276809 7/39 (18%)
CHIP_TPR_N 130..211 CDD:436460
RING-Ubox_CHIP 213..283 CDD:438316
TTL3NP_565976.1 TPR 213..>382 CDD:440225 31/123 (25%)
TPR repeat 220..248 CDD:276809 7/25 (28%)
TPR repeat 253..283 CDD:276809 9/29 (31%)
TPR 411..>578 CDD:440225
TPR repeat 412..440 CDD:276809
TPR repeat 491..521 CDD:276809
TPR repeat 526..550 CDD:276809
TRX_family 598..687 CDD:239245
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.