DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and SPAG1

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_003105.2 Gene:SPAG1 / 6674 HGNCID:11212 Length:926 Species:Homo sapiens


Alignment Length:295 Identity:73/295 - (24%)
Similarity:115/295 - (38%) Gaps:100/295 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDI-DGN 80
            |||:||.....:.|.||::.||:.:..|......:||||||.|||.::|...||..:||.: |||
Human   626 LKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGN 690

  Fly    81 LLKGHFFLGQGLMEIDNFDEAIKHLQRA-YDLSKEQKQNFGDDITLQLRLARKKRWNVMEEKRIQ 144
            :   ..|..:.|..     :.:|:.|:: .||:|         :.|            ::...|:
Human   691 V---KAFYRRALAH-----KGLKNYQKSLIDLNK---------VIL------------LDPSIIE 726

  Fly   145 QEIELQSYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQEIEQECDDHIKELNNIFSKVDERRK 209
            .::||:..          :||.|           ||||.....:|     ||...|  ::.|..:
Human   727 AKMELEEV----------TRLLN-----------LKDKTAPFNKE-----KERRKI--EIQEVNE 763

  Fly   210 KREVPDFLCGKISFEILTD----------------PVITPSGITYE----------RKDIE--EH 246
            .:|.|....|::|...|..                |:..|:. .||          |||.|  .|
Human   764 GKEEPGRPAGEVSMGCLASEKGGKSSRSPEDPEKLPIAKPNN-AYEFGQIINALSTRKDKEACAH 827

  Fly   247 LQRVGHFDPVTRVKLTQDQLIPNF-SMKEVVDSFI 280
            |           :.:|..:.:|.| |.|...|:|:
Human   828 L-----------LAITAPKDLPMFLSNKLEGDTFL 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 10/24 (42%)
TPR 21..>111 CDD:440225 29/91 (32%)
TPR repeat 47..77 CDD:276809 14/29 (48%)
TPR repeat 82..110 CDD:276809 4/28 (14%)
CHIP_TPR_N 130..211 CDD:436460 15/80 (19%)
RING-Ubox_CHIP 213..283 CDD:438316 21/97 (22%)
SPAG1NP_003105.2 3a0801s09 141..>339 CDD:273380
TPR 1 209..242
TPR repeat 213..237 CDD:276809
TPR repeat 242..271 CDD:276809
TPR 2 244..275
TPR 3 276..309
TPR repeat 276..304 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..452
TPR 4 445..478
3a0801s09 <446..>731 CDD:273380 37/133 (28%)
TPR repeat 448..481 CDD:276809
TPR repeat 486..516 CDD:276809
TPR 5 487..520
TPR repeat 521..549 CDD:276809
TPR 6 522..554
TPR 7 623..656 11/29 (38%)
TPR repeat 624..651 CDD:276809 10/24 (42%)
TPR repeat 656..686 CDD:276809 14/29 (48%)
TPR 8 657..690 15/32 (47%)
TPR repeat 691..718 CDD:276809 7/43 (16%)
TPR 9 692..724 8/57 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..801 7/42 (17%)
RPAP3_C 803..894 CDD:464012 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.