DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and unc-45

DIOPT Version :9

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster


Alignment Length:128 Identity:36/128 - (28%)
Similarity:59/128 - (46%) Gaps:13/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KEQGNCLFAARKYDDAINCYSKAI---IKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDG 79
            |::||..|.|.::::|:..|.|||   .|:...|.::.|||...|||.::|...:|...:|....
  Fly    17 KDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAAP 81

  Fly    80 NLLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQKQNFGDDITLQLRLARKKRWNVMEEKR 142
            ...|..|...|....::.|:||.|.....:......|       |:|..|   :|.:|:.|:|
  Fly    82 GDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNK-------TVQPML---QRLHVVVEER 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 21/62 (34%)
TPR 17..47 CDD:197478 11/31 (35%)
TPR repeat 17..42 CDD:276809 10/26 (38%)
TPR repeat 47..77 CDD:276809 10/29 (34%)
TPR repeat 82..110 CDD:276809 7/27 (26%)
U-box 213..285 CDD:252675
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 21/63 (33%)
TPR repeat 16..41 CDD:276809 9/23 (39%)
TPR repeat 46..79 CDD:276809 10/32 (31%)
TPR_11 50..115 CDD:290150 17/64 (27%)
TPR 50..83 CDD:197478 10/32 (31%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.