DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and unc-45

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_524796.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0288846 Length:947 Species:Drosophila melanogaster


Alignment Length:128 Identity:36/128 - (28%)
Similarity:59/128 - (46%) Gaps:13/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KEQGNCLFAARKYDDAINCYSKAI---IKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDG 79
            |::||..|.|.::::|:..|.|||   .|:...|.::.|||...|||.::|...:|...:|....
  Fly    17 KDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAAP 81

  Fly    80 NLLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQKQNFGDDITLQLRLARKKRWNVMEEKR 142
            ...|..|...|....::.|:||.|.....:......|       |:|..|   :|.:|:.|:|
  Fly    82 GDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNK-------TVQPML---QRL
HVVVEER 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 10/26 (38%)
TPR 21..>111 CDD:440225 27/92 (29%)
TPR repeat 47..77 CDD:276809 10/29 (34%)
TPR repeat 82..110 CDD:276809 7/27 (26%)
CHIP_TPR_N 130..211 CDD:436460 4/13 (31%)
RING-Ubox_CHIP 213..283 CDD:438316
unc-45NP_524796.1 3a0801s09 7..>127 CDD:273380 32/119 (27%)
TPR repeat 16..41 CDD:276809 9/23 (39%)
TPR repeat 46..79 CDD:276809 10/32 (31%)
UNC45-central 351..494 CDD:432011
PLN03200 399..>700 CDD:215629
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.