DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and spag

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster


Alignment Length:97 Identity:31/97 - (31%)
Similarity:48/97 - (49%) Gaps:4/97 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YSTTNLSDLQLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDS 71
            |...|    .:|::||......:|:.||..||.||...|.:..|..|||||.||.:.::.|.:|.
  Fly    93 YKKAN----DIKDRGNTYVKQGEYEKAIVAYSTAIAVYPHDPIYHINRALCYLKQESFDQCVEDC 153

  Fly    72 RRALDIDGNLLKGHFFLGQGLMEIDNFDEAIK 103
            ..|:.:|...:|.::...|....:.|..||:|
  Fly   154 EAAIALDKLCVKAYYRRMQANESLGNNMEALK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 9/24 (38%)
TPR 21..>111 CDD:440225 28/83 (34%)
TPR repeat 47..77 CDD:276809 11/29 (38%)
TPR repeat 82..110 CDD:276809 6/22 (27%)
CHIP_TPR_N 130..211 CDD:436460
RING-Ubox_CHIP 213..283 CDD:438316
spagNP_524664.1 TPR repeat 96..124 CDD:276809 10/31 (32%)
TPR 102..>211 CDD:440225 28/84 (33%)
TPR repeat 129..159 CDD:276809 11/29 (38%)
TPR repeat 164..192 CDD:276809 6/22 (27%)
PLN03209 <296..416 CDD:178748
RPAP3_C 416..503 CDD:464012
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.