DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and spag

DIOPT Version :9

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster


Alignment Length:97 Identity:31/97 - (31%)
Similarity:48/97 - (49%) Gaps:4/97 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YSTTNLSDLQLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDS 71
            |...|    .:|::||......:|:.||..||.||...|.:..|..|||||.||.:.::.|.:|.
  Fly    93 YKKAN----DIKDRGNTYVKQGEYEKAIVAYSTAIAVYPHDPIYHINRALCYLKQESFDQCVEDC 153

  Fly    72 RRALDIDGNLLKGHFFLGQGLMEIDNFDEAIK 103
            ..|:.:|...:|.::...|....:.|..||:|
  Fly   154 EAAIALDKLCVKAYYRRMQANESLGNNMEALK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 22/60 (37%)
TPR 17..47 CDD:197478 11/29 (38%)
TPR repeat 17..42 CDD:276809 9/24 (38%)
TPR repeat 47..77 CDD:276809 11/29 (38%)
TPR repeat 82..110 CDD:276809 6/22 (27%)
U-box 213..285 CDD:252675
spagNP_524664.1 TPR_11 95..161 CDD:290150 23/69 (33%)
TPR repeat 96..124 CDD:276809 10/31 (32%)
TPR_1 102..129 CDD:278916 10/26 (38%)
TPR repeat 129..159 CDD:276809 11/29 (38%)
TPR 130..160 CDD:197478 11/29 (38%)
TPR_16 136..197 CDD:290168 16/50 (32%)
TPR repeat 164..192 CDD:276809 6/22 (27%)
RPAP3_C 415..503 CDD:290588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.