DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and CG6980

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster


Alignment Length:127 Identity:42/127 - (33%)
Similarity:69/127 - (54%) Gaps:16/127 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SDLQLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALD- 76
            ::|| :.|||..|.::||:.||..|.|||||...:|..:.|||||.:||:.::...:|.:..|: 
  Fly   128 AELQ-RSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEK 191

  Fly    77 -----IDGNLLKGHFFLGQGLMEIDNFDEAI----KH--LQRAYDLSKEQKQNFGDDITLQL 127
                 :...|.:.|.:  :||.:.|.|:|::    :|  .|.|| :.|..||...|...|::
  Fly   192 LQESNLRAWLYQAHAY--KGLKQDDKFEESVVKAREHNPKQLAY-IDKYIKQLEADLKALEI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 11/24 (46%)
TPR 21..>111 CDD:440225 34/101 (34%)
TPR repeat 47..77 CDD:276809 10/35 (29%)
TPR repeat 82..110 CDD:276809 9/33 (27%)
CHIP_TPR_N 130..211 CDD:436460
RING-Ubox_CHIP 213..283 CDD:438316
CG6980NP_651289.1 Spy 117..>233 CDD:443119 35/107 (33%)
TPR repeat 128..156 CDD:276809 13/28 (46%)
TPR repeat 161..192 CDD:276809 10/30 (33%)
TPR repeat 197..225 CDD:276809 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.