DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and Sgt

DIOPT Version :9

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001246058.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster


Alignment Length:221 Identity:54/221 - (24%)
Similarity:96/221 - (43%) Gaps:39/221 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IYSTTNLSDLQL----KEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWEL 66
            :|:..|...|.|    |.:||.|....||::|:..|::||..:|.|..::.|||..:::|...|.
  Fly   104 LYTERNPESLALAESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENER 168

  Fly    67 CCQDSRRALDIDGNLLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQ---KQNFGDDITLQLR 128
            ...|.:.||..:.|..|.:..||.....:.||::|.:...:|.:|..:.   |.|        |.
  Fly   169 AVTDCKSALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSN--------LE 225

  Fly   129 LARKKRWNVMEEKRIQQEIELQSYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQE------IE 187
            .||..|....:..|:::::     :|.|    .:..:.||..|..:..|||....|.      |.
  Fly   226 AARNARNQPPQTGRLREDL-----INML----SQPMVRNLFNNAEIDVEQLLSMLQNPMIMNTIR 281

  Fly   188 QEC---------DDHIKELNNIFSKV 204
            |:.         :|.::.:.|:.|::
  Fly   282 QQFGGGNAPTLPNDMVQMIYNMTSQL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 21/64 (33%)
TPR 17..47 CDD:197478 12/33 (36%)
TPR repeat 17..42 CDD:276809 10/28 (36%)
TPR repeat 47..77 CDD:276809 9/29 (31%)
TPR repeat 82..110 CDD:276809 7/27 (26%)
U-box 213..285 CDD:252675
SgtNP_001246058.1 SGTA_dimer 9..>48 CDD:293154
TPR_11 116..177 CDD:290150 18/60 (30%)
TPR_2 116..149 CDD:285020 11/32 (34%)
TPR repeat 116..144 CDD:276809 9/27 (33%)
TPR_17 139..170 CDD:290167 10/30 (33%)
TPR repeat 149..179 CDD:276809 9/29 (31%)
TPR_16 156..218 CDD:290168 16/61 (26%)
TPR_1 184..217 CDD:278916 8/32 (25%)
TPR repeat 184..212 CDD:276809 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.