Sequence 1: | NP_477441.1 | Gene: | STUB1 / 34433 | FlyBaseID: | FBgn0027052 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246058.1 | Gene: | Sgt / 35052 | FlyBaseID: | FBgn0032640 | Length: | 331 | Species: | Drosophila melanogaster |
Alignment Length: | 221 | Identity: | 54/221 - (24%) |
---|---|---|---|
Similarity: | 96/221 - (43%) | Gaps: | 39/221 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 IYSTTNLSDLQL----KEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWEL 66
Fly 67 CCQDSRRALDIDGNLLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQ---KQNFGDDITLQLR 128
Fly 129 LARKKRWNVMEEKRIQQEIELQSYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQE------IE 187
Fly 188 QEC---------DDHIKELNNIFSKV 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
STUB1 | NP_477441.1 | TPR_11 | 17..78 | CDD:290150 | 21/64 (33%) |
TPR | 17..47 | CDD:197478 | 12/33 (36%) | ||
TPR repeat | 17..42 | CDD:276809 | 10/28 (36%) | ||
TPR repeat | 47..77 | CDD:276809 | 9/29 (31%) | ||
TPR repeat | 82..110 | CDD:276809 | 7/27 (26%) | ||
U-box | 213..285 | CDD:252675 | |||
Sgt | NP_001246058.1 | SGTA_dimer | 9..>48 | CDD:293154 | |
TPR_11 | 116..177 | CDD:290150 | 18/60 (30%) | ||
TPR_2 | 116..149 | CDD:285020 | 11/32 (34%) | ||
TPR repeat | 116..144 | CDD:276809 | 9/27 (33%) | ||
TPR_17 | 139..170 | CDD:290167 | 10/30 (33%) | ||
TPR repeat | 149..179 | CDD:276809 | 9/29 (31%) | ||
TPR_16 | 156..218 | CDD:290168 | 16/61 (26%) | ||
TPR_1 | 184..217 | CDD:278916 | 8/32 (25%) | ||
TPR repeat | 184..212 | CDD:276809 | 7/27 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462412 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |