DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and HIP

DIOPT Version :9

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_570074.3 Gene:HIP / 318211 FlyBaseID:FBgn0260484 Length:377 Species:Drosophila melanogaster


Alignment Length:174 Identity:47/174 - (27%)
Similarity:82/174 - (47%) Gaps:31/174 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDGN 80
            :|:.|....:..:|:|:||..|:|||..:|.||.:...|....||||:...|.:|...||:::.:
  Fly   128 ELRAQAASAYGQQKFDEAIALYTKAIELSPGNALFHAKRGQAFLKLKKPNACIRDCDVALELNSD 192

  Fly    81 LLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQKQNFGDDITLQLR----LARKKRWNVMEEK 141
            |..|:.|.|:....:.:|:.|      |:||.:..|.:|.::....|:    .|:|     :|:.
  Fly   193 LAAGYKFRGRARRLLGDFELA------AHDLRQACKLDFDEETDEWLKEVTPNAKK-----IEQH 246

  Fly   142 RIQQEIELQSYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQE 185
            |::|                |.|.|..|:.....|::...|:||
  Fly   247 RLKQ----------------ERRQAERKIKERQRDQRRARKEQE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 22/60 (37%)
TPR 17..47 CDD:197478 11/29 (38%)
TPR repeat 17..42 CDD:276809 9/24 (38%)
TPR repeat 47..77 CDD:276809 11/29 (38%)
TPR repeat 82..110 CDD:276809 6/27 (22%)
U-box 213..285 CDD:252675
HIPNP_570074.3 Hip_N 10..47 CDD:271228
TPR_11 125..190 CDD:290150 22/61 (36%)
TPR_2 126..159 CDD:285020 11/30 (37%)
TPR repeat 126..154 CDD:276809 9/25 (36%)
TPR repeat 159..189 CDD:276809 11/29 (38%)
TPR repeat 194..222 CDD:276809 8/33 (24%)
STI1 299..336 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.