DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and Tomm34

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001037709.1 Gene:Tomm34 / 311621 RGDID:1309029 Length:309 Species:Rattus norvegicus


Alignment Length:112 Identity:30/112 - (26%)
Similarity:56/112 - (50%) Gaps:10/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDGNL 81
            |||:||.|.....:..||..||::::.:...:..::|||||:|.||:::...:|...||.:||..
  Rat   196 LKEEGNELVKKGNHKKAIEKYSESLLFSSLESATYSNRALCHLVLKQYKEAEKDCTEALKLDGKN 260

  Fly    82 LKGHFFLGQGLMEIDNFDEAIKHLQR----------AYDLSKEQKQN 118
            :|..:...|....:.::..::..:..          |:.|.:|..||
  Rat   261 VKAFYRRAQAYKALKDYKSSLADISSLLQIEPRNGPAHKLRQEVNQN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 10/24 (42%)
TPR 21..>111 CDD:440225 23/99 (23%)
TPR repeat 47..77 CDD:276809 11/29 (38%)
TPR repeat 82..110 CDD:276809 3/37 (8%)
CHIP_TPR_N 130..211 CDD:436460
RING-Ubox_CHIP 213..283 CDD:438316
Tomm34NP_001037709.1 TPR 1 9..42
TPR repeat 9..37 CDD:276809
3a0801s09 <11..>294 CDD:273380 25/97 (26%)
TPR repeat 50..80 CDD:276809
TPR 2 51..84
TPR repeat 85..113 CDD:276809
TPR 3 86..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..187
TPR 4 193..226 10/29 (34%)
TPR repeat 193..221 CDD:276809 10/24 (42%)
TPR repeat 226..256 CDD:276809 11/29 (38%)
TPR 5 227..260 13/32 (41%)
TPR repeat 261..289 CDD:276809 2/27 (7%)
TPR 6 262..294 2/31 (6%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.