DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and Stip1

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_620266.1 Gene:Stip1 / 192277 RGDID:621599 Length:543 Species:Rattus norvegicus


Alignment Length:290 Identity:62/290 - (21%)
Similarity:105/290 - (36%) Gaps:65/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QLKEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDGN 80
            :|||:||...:|...|||:.|||:||..:|.|...::||:....|...::...:|..:.:|:..:
  Rat     6 ELKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD 70

  Fly    81 LLKGHFFLGQGLMEIDNFDEA-------IKHLQRAYDLSKEQKQNFGDDITLQLRLARKKRWNVM 138
            ..||:......|..::.|:||       :||......| ||..||      ::.|||.:|..|..
  Rat    71 WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNLQL-KEGLQN------MEARLAERKFMNPF 128

  Fly   139 EEKRIQQEIELQSYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQEIEQECDD-HIKELNNIFS 202
            ....:.|::|.......|:.......|.          |||::|..::..:..| .:....::..
  Rat   129 NLPNLYQKLENDPRTRTLLSDPTYRELI----------EQLQNKPSDLGTKLQDPRVMTTLSVLL 183

  Fly   203 KVDERRKKREVPDFLCGKISFEILTDPVITP---------------------------SGITYER 240
            .||......|.          |..|.|...|                           ....|::
  Rat   184 GVDLGSMDEEE----------EAATPPPPPPPKKEAKPEPMEEDLPENKKQALKEKELGNDAYKK 238

  Fly   241 KDIE---EHLQRVGHFDPVTRVKLTQDQLI 267
            ||.:   :|..:....||.....:|....:
  Rat   239 KDFDKALKHYDKAKELDPTNMTYITNQAAV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 13/24 (54%)
TPR 21..>111 CDD:440225 26/96 (27%)
TPR repeat 47..77 CDD:276809 5/29 (17%)
TPR repeat 82..110 CDD:276809 8/34 (24%)
CHIP_TPR_N 130..211 CDD:436460 14/81 (17%)
RING-Ubox_CHIP 213..283 CDD:438316 11/85 (13%)
Stip1NP_620266.1 TPR 1 4..37 15/30 (50%)
3a0801s09 <7..532 CDD:273380 62/289 (21%)
TPR repeat 7..32 CDD:276809 13/24 (54%)
TPR repeat 37..67 CDD:276809 5/29 (17%)
TPR 2 39..71 5/31 (16%)
TPR repeat 72..100 CDD:276809 6/27 (22%)
TPR 3 73..105 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..233 5/51 (10%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 222..239 1/16 (6%)
TPR 4 225..258 6/32 (19%)
TPR repeat 229..253 CDD:276809 4/23 (17%)
TPR repeat 258..288 CDD:276809 1/11 (9%)
TPR 5 260..292 1/9 (11%)
TPR 6 300..333
TPR repeat 300..328 CDD:276809
TPR 7 360..393
TPR repeat 364..388 CDD:276809
TPR repeat 393..423 CDD:276809
TPR 8 395..427
TPR 9 428..461
TPR repeat 428..456 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.