DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and sti-1

DIOPT Version :10

Sequence 1:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001367444.1 Gene:sti-1 / 178587 WormBaseID:WBGene00019983 Length:320 Species:Caenorhabditis elegans


Alignment Length:93 Identity:27/93 - (29%)
Similarity:47/93 - (50%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KEQGNCLFAARKYDDAINCYSKAIIKNPTNATYFTNRALCNLKLKRWELCCQDSRRALDIDGNLL 82
            |.:||..|....|..|:..|::|:.::|.||..::|||.|..||..::....|....:.:|...:
 Worm   144 KNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFI 208

  Fly    83 KGHFFLGQGLMEIDNFDEAIKHLQRAYD 110
            ||:......|:.:..:.:|    ||||:
 Worm   209 KGYIRKAACLVAMREWSKA----QRAYE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_477441.1 TPR repeat 17..42 CDD:276809 8/23 (35%)
TPR 21..>111 CDD:440225 26/90 (29%)
TPR repeat 47..77 CDD:276809 9/29 (31%)
TPR repeat 82..110 CDD:276809 7/27 (26%)
CHIP_TPR_N 130..211 CDD:436460
RING-Ubox_CHIP 213..283 CDD:438316
sti-1NP_001367444.1 TPR repeat 5..33 CDD:276809
LapB 11..264 CDD:442196 27/93 (29%)
TPR repeat 38..68 CDD:276809
TPR repeat 80..108 CDD:276809
TPR repeat 140..168 CDD:276809 8/23 (35%)
TPR repeat 173..203 CDD:276809 9/29 (31%)
TPR repeat 208..236 CDD:276809 8/29 (28%)
STI1 259..311 CDD:436075
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.