DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D5

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001127853.1 Gene:TBC1D5 / 9779 HGNCID:19166 Length:817 Species:Homo sapiens


Alignment Length:354 Identity:67/354 - (18%)
Similarity:133/354 - (37%) Gaps:116/354 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPE------------- 439
            |...|.||. |..|....::.:|...:.:...::...:..|..|....:.|:             
Human    50 GTFNSYRKE-WEELFVNNNYLATIRQKGINGQLRSSRFRSICWKLFLCVLPQDKSQWISRIEELR 113

  Fly   440 ------QQIH-------------------------FW------KTVQIVVEKDVVRTDRTNPFFC 467
                  ::||                         .|      |.::.::|:||.||.....|| 
Human   114 AWYSNIKEIHITNPRKVVGQQDLMINNPLSQDEGSLWNKFFQDKELRSMIEQDVKRTFPEMQFF- 177

  Fly   468 GDDNPNT-EVMKNILLNFAVYNTGMSYSQGMSDLLAPVL----CEVQN----------------- 510
              ...|. :::.::|..:|..|..:.|.|||.:||||::    |:.|.                 
Human   178 --QQENVRKILTDVLFCYARENEQLLYKQGMHELLAPIVFVLHCDHQAFLHASESAQPSEEMKTV 240

  Fly   511 ------ESETFWCFVGLMQRA--FF-------------VCTP----TDRDVDHNLSYLRELIRIM 550
                  |.:.:..|..||:.|  :|             :.||    ..:|:...::.:.::.:|.
Human   241 LNPEYLEHDAYAVFSQLMETAEPWFSTFEHDGQKGKETLMTPIPFARPQDLGPTIAIVTKVNQIQ 305

  Fly   551 LPHFYKH---LEQHNDSMEL---LFCHRWLLLCFKREFTEAVVIRMWEACWSNYLT----DYFHL 605
            .....||   |..|.:.:|:   ::..||:.|.|.|||....::.:|:|.:::.|:    ||   
Human   306 DHLLKKHDIELYMHLNRLEIAPQIYGLRWVRLLFGREFPLQDLLVVWDALFADGLSLGLVDY--- 367

  Fly   606 FLCLAIIAVYADDVVAQNLRPD-EMLLHF 633
             :.:|::....|.:::.|.:.. .:|:|:
Human   368 -IFVAMLLYIRDALISSNYQTCLGLLMHY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 63/336 (19%)
TBC1D5NP_001127853.1 TBC 79..381 CDD:214540 57/308 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.