DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and BUB2

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_013771.1 Gene:BUB2 / 855077 SGDID:S000004659 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:316 Identity:69/316 - (21%)
Similarity:116/316 - (36%) Gaps:70/316 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 LRKCVFFGGL----EKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQ 440
            ||..:...||    :|..::|      :||.::...:   ..|:...|.|     ..|..:.|..
Yeast    22 LRYLILSEGLPISEDKQQQRT------RCYVWTVLSQ---TSMEASTQRY-----LALLKLGPPS 72

  Fly   441 QIHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLN----FAVYNTGM---------- 491
                 .|:...::.|..||.:|:|.|      ...|.::.|:.    || :.|..          
Yeast    73 -----TTIYQKIKNDTSRTFQTDPNF------RNRVSEDALIRCLSCFA-WQTQQRRQKTRFGRI 125

  Fly   492 ---SYSQGMSDLLAPVLCEVQNESETFWCFVGLMQRAFFVCTPTDRDVDHNLSYLREL-IRIMLP 552
               :|.|||:.||||:|....:|...:..|..|...........:.:...|.:.|.:: :||:.|
Yeast   126 PVSTYVQGMNVLLAPLLYSCPSEPMAYQLFTKLCYEMIPTYLTKNLNGAQNGAKLLDISLRIIDP 190

  Fly   553 HFYKHLEQHNDSMELLFCHRWLLL--CFKREFTEAVVIRMWEACWSNYLTDY-FHL-FLCLAIIA 613
            ...|.|..:..:.|:......|.|  |.|   ....||::|:     ::..| ||: .|.:....
Yeast   191 KLSKFLSDNLLTAEIYGMPSILTLSSCNK---PLDQVIKLWD-----FMFAYGFHMNILFVVAFL 247

  Fly   614 VYADDVVAQNLRPDEMLLHFSSLAMYMDGQLILRKARGLLHQYRQLPKIPCTLSGL 669
            |.....|.::..|..:|..|..    .|...|:|...|.      :.|||..:..|
Yeast   248 VKMRSKVFKSDSPVNLLRQFPD----FDADEIIRLGVGF------IAKIPAQIYDL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 55/256 (21%)
BUB2NP_013771.1 COG5210 <1..304 CDD:227535 69/316 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.