DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and AT5G24390

DIOPT Version :10

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_197827.1 Gene:AT5G24390 / 832510 AraportID:AT5G24390 Length:528 Species:Arabidopsis thaliana


Alignment Length:32 Identity:8/32 - (25%)
Similarity:16/32 - (50%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLSKCIIKTMGDGTSSLKSNKSRVTFSDMET 32
            ::|....:...|..|..||.:::.:|.|:..|
plant     8 ILLIALFVSVQGSVTDKLKFDEALLTVSNYLT 39

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540
AT5G24390NP_197827.1 TBC <322..482 CDD:214540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.