DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and AT2G43490

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001118514.1 Gene:AT2G43490 / 818950 AraportID:AT2G43490 Length:745 Species:Arabidopsis thaliana


Alignment Length:268 Identity:80/268 - (29%)
Similarity:118/268 - (44%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 WKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQ 509
            |...:|||  ||||||....|:  :|..|...|.:||..:|..:....|.||||||::|.:...:
plant   357 WTLHRIVV--DVVRTDSHLEFY--EDPGNLGRMSDILAVYAWVDPATGYCQGMSDLVSPFVVLFE 417

  Fly   510 NESETFWCFVGLMQRA---FFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCH 571
            :.::.||||..|::|.   |.:..||  .|...|..|..:::|.....:.||.:.. :..|.|..
plant   418 DNADAFWCFEMLIRRTRANFQMEGPT--GVMDQLQSLWHILQITDKDIFSHLSRIG-AESLHFAF 479

  Fly   572 RWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPD---EMLLHF 633
            |.||:.|:||.:....:||||..|:   .||              |:.|.:.|..|   .:::..
plant   480 RMLLVLFRRELSFNEALRMWEMMWA---ADY--------------DESVTETLENDCLEPLVIQL 527

  Fly   634 S-------SLAMYMDG--------QLI-----LRKARGLLHQYRQLPKIPCTLSG-LCKRCGPGM 677
            .       |..|..||        .:|     :.|:.|||.:...|||     || |.|..||..
plant   528 PRKSEPEVSEEMIEDGIGNSTKREPMISKSGPISKSSGLLSRSGLLPK-----SGPLPKTAGPFS 587

  Fly   678 WDSEHRPA 685
            .:||.:.|
plant   588 DESEIKSA 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 55/175 (31%)
AT2G43490NP_001118514.1 TBC <358..508 CDD:214540 54/173 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.