DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and GRTP1

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001273661.1 Gene:GRTP1 / 79774 HGNCID:20310 Length:344 Species:Homo sapiens


Alignment Length:263 Identity:61/263 - (23%)
Similarity:101/263 - (38%) Gaps:61/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 KDVVRTD--RTNPFFCGDDNPN---------TEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCE 507
            :|.:|||  ||.|     ||..         ...:.|:||.:..:|.|:.|.|||:.:...::..
Human   108 EDAIRTDLNRTFP-----DNVKFRKTTDPCLQRTLYNVLLAYGHHNQGVGYCQGMNFIAGYLILI 167

  Fly   508 VQNESETFWCFVGLMQRAF-------FVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSM 565
            ..||.|:||....|:.|..       .:...||::|      |.||:|..||.....:|:.....
Human   168 TNNEEESFWLLDALVGRILPDYYSPAMLGLKTDQEV------LGELVRAKLPAVGALMERLGVLW 226

  Fly   566 ELLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEML 630
            .|| ..||.:..|........|:|:|:..::......|.:.|.|          :.|:   .|::
Human   227 TLL-VSRWFICLFVDILPVETVLRIWDCLFNEGSKIIFRVALTL----------IKQH---QELI 277

  Fly   631 LHFSSLAMYMDGQLILRKARGLLHQYRQLPK----IPC-TLSGLCKRCGPGMWDSEHRPALECVG 690
            |..:|:....|             :::|:.|    :.| |...:|......:......|.|:..|
Human   278 LEATSVPDICD-------------KFKQITKGSFVMECHTFMQVCGAARGSVPSQGAPPHLQPGG 329

  Fly   691 HSD 693
            .||
Human   330 CSD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 46/181 (25%)
GRTP1NP_001273661.1 TBC 65..278 CDD:214540 48/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.