DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and TBC1D17

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_078958.2 Gene:TBC1D17 / 79735 HGNCID:25699 Length:648 Species:Homo sapiens


Alignment Length:570 Identity:152/570 - (26%)
Similarity:246/570 - (43%) Gaps:112/570 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 RPDSNNCSDCTNGSGVGDGPATD---NPKWTT-----PELLAFKHNLEFPDSGNSTPADRQKSAM 255
            :.||:....|.:    .:.|..|   .|.|..     |:|...:     |..| :.|:..|.|..
Human    64 KKDSSGGDSCAS----EEEPTFDPGYEPDWAVISTVRPQLCHSE-----PTRG-AEPSCPQGSWA 118

  Fly   256 KCRHFSVDLSQMRSLRLFFNDDNCTSGQLVIASRE-SQYKILHFHYGGLDHLAQVLHQW------ 313
                |||.|.:::|:|.  :....:...||:.::. .....||||.||...|.:||.::      
Human   119 ----FSVSLGELKSIRR--SKPGLSWAYLVLVTQAGGSLPALHFHRGGTRALLRVLSRYLLLASS 177

  Fly   314 ------------------HCFLH---------NITSETGQDKFDLPYRHF----------MVCRP 341
                              :.|.|         |:.|...||.:...:..|          :..:|
Human   178 PQDSRLYLVFPHDSSALSNSFHHLQLFDQDSSNVVSRFLQDPYSTTFSSFSRVTNFFRGALQPQP 242

  Fly   342 EVKKSEMHPDEGDVKK---------------------ITTNFFYGTLLNEKGQIEDDLLLRKCVF 385
            |...|::.|...|..:                     ..|...:...:..:|:::....|:..:|
Human   243 EGAASDLPPPPDDEPEPGFEVISCVELGPRPTVERGPPVTEEEWARHVGPEGRLQQVPELKNRIF 307

  Fly   386 FGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLY--SMSPEQQ-----IH 443
            .|||..|||:..|.|||...|:..|.|:....:   |::.:|..|.:|.  |:||||:     :|
Human   308 SGGLSPSLRREAWKFLLGYLSWEGTAEEHKAHI---RKKTDEYFRMKLQWKSVSPEQERRNSLLH 369

  Fly   444 FWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEV 508
            .:::   ::|:||.||||||.|:.|.:||...::.:|||.:.:|:..:.|.|||||||:|:|..:
Human   370 GYRS---LIERDVSRTDRTNKFYEGPENPGLGLLNDILLTYCMYHFDLGYVQGMSDLLSPILYVI 431

  Fly   509 QNESETFWCFVGLMQRAFFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHNDSMELLFCHRW 573
            |||.:.||||.|.|:........:...:...|..|..|:|::.|.....|:. .||..|.||.||
Human   432 QNEVDAFWCFCGFMELVQGNFEESQETMKRQLGRLLLLLRVLDPLLCDFLDS-QDSGSLCFCFRW 495

  Fly   574 LLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEMLLHFSSLAM 638
            ||:.|||||....|:|:||..|:.......||.:..||:.:..|.::......:|:|.|.:.|.|
Human   496 LLIWFKREFPFPDVLRLWEVLWTGLPGPNLHLLVACAILDMERDTLMLSGFGSNEILKHINELTM 560

  Fly   639 YMDGQLILRKARGLLHQYRQLPKIPCTLS---GLCKRCGPGMWDSEHRPA 685
            .:..:.:|.:|..|..|....|::|..:.   ||.....|      |.|:
Human   561 KLSVEDVLTRAEALHRQLTACPELPHNVQEILGLAPPAEP------HSPS 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 88/237 (37%)
TBC1D17NP_078958.2 DUF3548 5..218 CDD:192931 35/169 (21%)
Required for interaction with OPTN. /evidence=ECO:0000269|PubMed:22854040 218..309 11/90 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..259 5/18 (28%)
TBC 307..542 CDD:214540 90/241 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..648 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.