DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Tbc1d21

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_083130.1 Gene:Tbc1d21 / 74286 MGIID:1921536 Length:336 Species:Mus musculus


Alignment Length:312 Identity:72/312 - (23%)
Similarity:138/312 - (44%) Gaps:49/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 PEVKKSEMHPDEGDVKKITTNFF--YGTLLNEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLLK 403
            |.:.|:|.           .:||  .|.|...:..|..::|.|      ||...:|...|.||..
Mouse    25 PPIDKAEW-----------DSFFDENGHLAKSRDFICINILER------GLHPFVRTEAWKFLTG 72

  Fly   404 CYSFSSTFEDRAVLMDIKRQEYEEITR---------KRLYSMSPEQQIHFWKTVQIVVEKDV--- 456
            .||:.|:.::|.::...:|:.|..:.:         :.|:....|.:.:....:|.:.:||.   
Mouse    73 YYSWQSSRDERLMVDSNRRRNYNSLCQMYEKIQPLLENLHGNFTETRNNIAYDIQRLYDKDPLGN 137

  Fly   457 VRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGL 521
            |..|:            .::.|.:||:: |.||...|.:|..:::......|:::.||||.|...
Mouse   138 VLIDK------------KKLEKTLLLSY-VCNTKAEYQRGFHEMVMLFQLMVEHDHETFWLFQFF 189

  Fly   522 MQRAFFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLE-QHNDSMELLFCHRWLLLCFKREF-TE 584
            :|:....|. .:..|..||..|..||.::.|.|.:||: :.:.:::.||  .|..|||:|.| |.
Mouse   190 LQKTEHSCV-INIGVGKNLDMLNSLITLLDPEFAEHLKGKGSGAVQSLF--PWFCLCFQRAFKTF 251

  Fly   585 AVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPDEMLLHFSSL 636
            ..|.|:||...:......|.:.:..:::.:..:..:.:.:..|.:|:..::|
Mouse   252 DDVWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQALLECMSGDAILMACNNL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 59/244 (24%)
Tbc1d21NP_083130.1 TBC 62..287 CDD:214540 57/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.