DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Tbc1d5

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001272920.1 Gene:Tbc1d5 / 72238 MGIID:1919488 Length:837 Species:Mus musculus


Alignment Length:327 Identity:69/327 - (21%)
Similarity:120/327 - (36%) Gaps:90/327 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 GGLEKS-LRKTVWPFLL------KCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQQIH- 443
            |.|..| .|...|...|      |....|...|.||....||.   ..||..|..:...:..|: 
Mouse    79 GQLRSSRFRSICWKLFLCVLPQDKSQWISKIKELRAWYSSIKE---IHITNPRKAAGQQDLMINN 140

  Fly   444 --------FW------KTVQIVVEKDVVRTDRTNPFFCGDDNPNT-EVMKNILLNFAVYNTGMSY 493
                    .|      |.::.::|:||.||.....||   ...|. :::.::|..:|..|..:.|
Mouse   141 PLSQDEGSLWNKFFQDKELRSMIEQDVKRTFPEMQFF---QQENVRKILTDVLFCYARENEQLLY 202

  Fly   494 SQGMSDLLAPVL----CEVQN-----------------------ESETFWCFVGLMQRAFFVCTP 531
            .|||.:||||::    |:.|.                       |.:.:..|..||:.|    .|
Mouse   203 KQGMHELLAPIIFTLHCDHQAFLHASESAQPSEEMKTLLNPEYLEHDAYAMFSQLMETA----EP 263

  Fly   532 TDRDVDHNLSYLRELIRIMLP----------------------HFYK----HLEQHNDSMEL--- 567
            .....:|:....:|.:...:|                      |..|    .|..|.:.:|:   
Mouse   264 WFSTFEHDGQKGKETLMAPIPFARPQDLGPTVAIVTKVNQIQDHLLKKHDIELYMHLNRLEIAPQ 328

  Fly   568 LFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIAVYADDVVAQNLRPD-EMLL 631
            ::..||:.|.|.|||....::.:|:|.:::.|......::..|::....|.:::.|.:.. .:|:
Mouse   329 IYGLRWVRLLFGREFPLQDLLVVWDALFADSLNLSLVDYVFTAMLLYIRDALISSNYQTCLGLLM 393

  Fly   632 HF 633
            |:
Mouse   394 HY 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 65/309 (21%)
Tbc1d5NP_001272920.1 TBC 79..381 CDD:214540 66/311 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.