DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and Tbc1d15

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_006514020.1 Gene:Tbc1d15 / 66687 MGIID:1913937 Length:688 Species:Mus musculus


Alignment Length:319 Identity:109/319 - (34%)
Similarity:174/319 - (54%) Gaps:31/319 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LNEKGQIEDDLLLRKCVFFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKR 432
            |:.:|::.....:::.:|.|||..||||..|.|||..:.:.||.|:|.   .:::|:.:|..|.:
Mouse   326 LDPEGRLVAVESMKQKIFRGGLSHSLRKQAWKFLLGYFPWDSTKEERT---QLQKQKTDEYFRMK 387

  Fly   433 LYSMSPEQQIHFWKTV--------------QIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLN 483
            |.          ||:|              :.::||||.||||||.|:.|.|||...::.:||:.
Mouse   388 LQ----------WKSVSEAQEKRNSRLRDYRSLIEKDVNRTDRTNKFYEGQDNPGLILLHDILMT 442

  Fly   484 FAVYNTGMSYSQGMSDLLAPVLCEVQNESETFWCFVGLMQRAFFVCTPTDRDVDHNLSYLRELIR 548
            :.:|:..:.|.|||||||:|:|..::||.:.||||...|.:.........:.:...|..|..|:|
Mouse   443 YCMYDFDLGYVQGMSDLLSPLLYVMENEVDAFWCFASYMDQMHQNFEEQMQGMKTQLIQLSTLLR 507

  Fly   549 IMLPHFYKHLEQHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEACWSNYLTDYFHLFLCLAIIA 613
            ::...|..:||. .||..|.||.||||:.|||||:...::|:||..|:......|||.||.||:.
Mouse   508 LLDSGFCSYLES-QDSGYLYFCFRWLLIRFKREFSFLDILRLWEVMWTELPCKNFHLLLCCAILE 571

  Fly   614 VYADDVVAQNLRPDEMLLHFSSLAMYMDGQLILRKARGL---LHQYRQLPKIPCTLSGL 669
            .....::|::...:|:|.|.:.|:|.:|.:.||.||..:   :.|.::||:..|.:.||
Mouse   572 SEKQQIMAKHYGFNEILKHINELSMKIDVEDILCKAEAISLQMAQCKELPQAVCEILGL 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 89/244 (36%)
Tbc1d15XP_006514020.1 DUF3548 10..211 CDD:371881
TBC 343..578 CDD:214540 90/248 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1495285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.