DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and tbc1d30

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_021331078.1 Gene:tbc1d30 / 569334 ZFINID:ZDB-GENE-030131-2064 Length:1063 Species:Danio rerio


Alignment Length:235 Identity:52/235 - (22%)
Similarity:96/235 - (40%) Gaps:60/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GLEKSLRKTVWPFLLKCYSFSST----------FEDRAVLMDIKRQEYEEITRKRLYSMSPEQQI 442
            |:.|..||.||..|...|..|.:          |.||:                     :|:.. 
Zfish   239 GIPKEWRKRVWLTLADQYLHSISIDWEKTMRFAFNDRS---------------------NPDDD- 281

  Fly   443 HFWKTVQIVVEKDVVRTDRTNPFFCGDD-NPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVLC 506
                ::.|.:.||:.||..::  :||.: ..:..|:|.:||.:|.:|..:.|.||. ::||.::.
Zfish   282 ----SLGIQIVKDLHRTGCSS--YCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGF-NVLAALIL 339

  Fly   507 EVQ--NESETFWCFVGLMQR----AFFVCTPTDRDVDHNLSYLRELIRIMLPHFYKHLE------ 559
            ||.  ||.:.....:.|:.:    ::|........||  ::..|:|:|:.||...:||.      
Zfish   340 EVTEGNEGDALKVMIYLIDKVLPDSYFANNLRALSVD--MAVFRDLLRLKLPELSQHLHHLQKVA 402

  Fly   560 ------QHNDSMELLFCHRWLLLCFKREFTEAVVIRMWEA 593
                  .:...:..:|..:|.|..|........|:::|::
Zfish   403 NREAGGSYEPPLTNVFTMQWFLTMFATCLPHHTVLKIWDS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 52/235 (22%)
tbc1d30XP_021331078.1 TBC 239..458 CDD:214540 52/235 (22%)
DUF4682 625..775 CDD:318030
HrpB7 733..>820 CDD:330448
Herpes_BLLF1 <825..>973 CDD:330317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.