DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and rabgap1l2

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_694092.1 Gene:rabgap1l2 / 565728 ZFINID:ZDB-GENE-070912-414 Length:320 Species:Danio rerio


Alignment Length:101 Identity:20/101 - (19%)
Similarity:33/101 - (32%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ERDIREEDENAADMQELKNELQPLLGGQAASIDDLTALLKNNPITSVNITISNPQIENSNISQSF 193
            |.||:..:...||.:::.::|...|..|....|...|.:|                  |.:.:..
Zfish   145 ESDIKRSNSIIADYKQICSQLNTKLENQKEEADKNLAFIK------------------SKLQECE 191

  Fly   194 NCITIRPDSNNCSDCTNGSGVGDGPATDNPKWTTPE 229
            .|..|.....:...|:...   |..|.|..|.:..|
Zfish   192 RCSRIFSVDGSIESCSESE---DRSAQDEAKTSLRE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540
rabgap1l2XP_694092.1 Smc <56..>265 CDD:224117 20/101 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.