DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBC1D16 and usp6nl

DIOPT Version :9

Sequence 1:NP_609403.2 Gene:TBC1D16 / 34431 FlyBaseID:FBgn0032249 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_005164934.1 Gene:usp6nl / 561983 ZFINID:ZDB-GENE-041210-192 Length:849 Species:Danio rerio


Alignment Length:358 Identity:85/358 - (23%)
Similarity:147/358 - (41%) Gaps:82/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 TPADRQKSAMKCRHFSVDLSQMRSLRLFFNDDNCTSGQLVIASRESQYKILHFHYGGLDHLAQVL 310
            |.:|.::.|      :|.|.|.|:..|...|......: |....|:.:::    |..:|...   
Zfish    23 TASDSEQDA------AVKLEQERAEILAKYDKGKEKAE-VEPWEETNFEL----YKAVDRFG--- 73

  Fly   311 HQWHCFLHNITSETGQDKFDLPYRHFMVCRPEVKKSEMHPDEGDVKKITTNFFYGTLLNEKGQIE 375
                 |||.     |:..:|:         .|.|:.::..:.      ||.:.......||.:..
Zfish    74 -----FLHE-----GELVYDI---------VEEKQKQLEVER------TTKWLKMLKSWEKYKNS 113

  Fly   376 DDLLLRKCVFFGGLEKSLRKTVWPFLLKCYSFSSTFEDRAVLMDIKRQEYEEITRKRLYSMSPEQ 440
            |.|:.|   .:.|:...||..||..||          |...:.:.|:..||:: :.|...:||:.
Zfish   114 DKLVRR---IYKGIPLQLRGQVWCLLL----------DIPKIKEEKKDFYEKL-KIRARGLSPDV 164

  Fly   441 QIHFWKTVQIVVEKDVVRTDRTNPFFCGDDNPNTEVMKNILLNFAVYNTGMSYSQGMSDLLAPVL 505
            :         .::.||.||.|.:..|....:...:.:.::|..::||||.:.|.||||.:.| :|
Zfish   165 R---------QIDLDVNRTYRNHIMFMHRYDVKQQDLFHVLTAYSVYNTEVGYCQGMSQITA-LL 219

  Fly   506 CEVQNESETFWCFVGLM--QR----AFFV--CTPTDRDVDHNLSYLRELIRIMLPHFYKHLEQHN 562
            ....||.:.||..|.|:  ||    .|||  .....|..:|:    ..:::.|:|    .|:||.
Zfish   220 LIYMNEEDAFWALVKLLSGQRHTMHGFFVPGFPKLMRFQEHH----DRILQKMMP----KLKQHL 276

  Fly   563 DSMEL---LFCHRWLLLCFKREFTEAVVIRMWE 592
            |:.|:   |:..:|...||.......:.:|:|:
Zfish   277 DNQEVYTSLYTMKWFFQCFLDRTPFTLTLRIWD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBC1D16NP_609403.2 TBC 387..618 CDD:214540 58/217 (27%)
usp6nlXP_005164934.1 TBC 120..326 CDD:214540 58/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.